CATH Domain: 1f7lA00 XML data for domain: 1f7lA00

Molscript image for 1f7lA00
1f7lA00
PDB coordinates for domain 1f7lA00

PDB 1f7l, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.470 Ribosomal Protein L22; Chain A
3.90.470.20 4'-phosphopantetheinyl transferase Gene3D
3.90.470.20.2
3.90.470.20.2.1
3.90.470.20.2.1.1
3.90.470.20.2.1.1.1
3.90.470.20.2.1.1.1.1

[top]
Segment boundaries for domain 1f7lA00

Chopping figure for domain 1f7lA00
DomainStart PDB ResidueStop PDB Residue
1f7lA00 1 118

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.90.470.20.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1qr0A01 81.07 Bacillus subtilis4'-phosphopantetheinyl transferase sfp 3.90.470.20 125 12 81 3.17 3.88
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1f7lA00
GIYGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEKRKNEFLAGRFAAKEAFSKAFGTGIGRQLSFQDIEIR
KDQNGKPYIICTKLSPAAVHVSITHTKEYAAAQVVIER
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1f7lA00
GIYGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEKRKNEFLAGRFAAKEAFSKAFGTGIGRQLSFQDIEIR
KDQNGKPYIICTKLSPAAVHVSITHTKEYAAAQVVIERLSS
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 17:55

Assigning to "3.90.470.20" based on similarity with "1f7tD00" (NWSI: 100, NWO: 99.1803278688525, SPS: 96.47, SPO: 99, RMSD: 1.06)

Flow stage update by auto on 28 Apr 2006 17:49

NW result present for Domain "1f7lA00"

Flow stage update by auto on 28 Apr 2006 17:42

All required files are present for Domain "1f7lA00"

Flow stage update by auto on 27 Apr 2006 17:30

Beginning processing for Domain "1f7lA00"

Insertion by auto on 05 Mar 2006 16:02

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"