Set cath from cathlist by auto on 05 Mar 2006 18:29
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1f60A01 | 2 | 236 |
| 1f60A02 | 239 | 327 |
| 1f60A03 | 333 | 440 |
There are 6 matching structural neighberhood comparisons for CATH ID 2.40.30.10.2.1.1.1.1 (SIMAX score < 5)
>pdb|1f60A03 KGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEA FSEYPPLGRFAVRDMRQTVAVGVIKSVD
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"