CATH Domain: 1f5mA00 XML data for domain: 1f5mA00

Molscript image for 1f5mA00
1f5mA00
PDB coordinates for domain 1f5mA00

PDB 1f5m, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.40 Gene3D
3.30.450.40.3
3.30.450.40.3.2
3.30.450.40.3.2.1
3.30.450.40.3.2.1.1
3.30.450.40.3.2.1.1.1

[top]
Segment boundaries for domain 1f5mA00

Chopping figure for domain 1f5mA00
DomainStart PDB ResidueStop PDB Residue
1f5mA00 4 179

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.30.450.40.3.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3eeaA00 84.36 GAF domain/HD domain proteinGeobacter sulfurreducens 3.30.450.40 153 10 88 3.86 4.34
2qybA00 83.89 Membrane protein, putativeGeobacter sulfurreducens 3.30.450.40 147 15 88 3.99 4.53
1mc0A01 81.98 Mus musculusCGMP-dependent 3',5'-cyclic phosphodiesterase 3.30.450.40 158 12 91 3.78 4.12
3citA00 81.92 Pseudomonas syringae pv. tomatoSensor histidine kinase 3.30.450.40 153 8 86 3.77 4.34
1ykdB02 80.83 Adenylate cyclaseAnabaena sp. 3.30.450.40 187 18 75 3.41 4.49
1stzA02 80.15 Thermotoga maritimaHeat-inducible transcription repressor hrcAHeat-inducible transcriptional repressor 3.30.450.40 149 9 84 3.44 4.08
1yspA00 79.64 Specific transcriptional repressor activitySequence-specific DNA binding transcription factor activityNegative regulation of gene-specific transcriptionTranscriptional regulator kdgREscherichia coli K-12 3.30.450.40 161 10 73 3.17 4.29
1ysqA00 77.90 Specific transcriptional repressor activityNegative regulation of transcription, DNA-dependentHTH-type transcriptional regulator yiaJEscherichia coli K-12 3.30.450.40 181 13 66 3.08 4.61
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1f5mA00
STGFHHADHVNYSSNLNKEEILEQLLLSYEGLSDGQVNWVCNLSNASSLIWHAYKSLAVDINWAGFYVTQASEENTLILG
PFQGKVACQMIQFGKGVCGTAASTKETQIVPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGFDHVDK
EFLEKLAKLINKSCVF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1f5mA00
MGSSTGFHHADHVNYSSNLNKEEILEQLLLSYEGLSDGQVNWVCNLSNASSLIWHAYKSLAVDINWAGFYVTQASEENTL
ILGPFQGKVACQMIQFGKGVCGTAASTKETQIVPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGFDH
VDKEFLEKLAKLINKSCVFK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:29

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"