Set cath from cathlist by auto on 05 Mar 2006 18:29
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1f20A01 | 1235 | 1397 |
| 1f20A02 | 963 | 987 |
| 1f20A02 | 1038 | 1171 |
| 1f20A03 | 988 | 1037 |
| 1f20A03 | 1172 | 1234 |
There are 14 matching structural neighberhood comparisons for CATH ID 2.40.30.10.5.1.1.1.1 (SIMAX score < 5)
>pdb|1f20A03 HKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGNQELQYQPGDHLGVFPPRYYSISSSPDMYPDEVHLTVAIVSYHTRD GEGPVHHGVCSSWLNRIQADDVVPCFVRGAPSF
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"