Set cath from cathlist by auto on 05 Mar 2006 18:47
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1f1sA01 | 628 | 902 |
| 1f1sA02 | 249 | 622 |
| 1f1sA03 | 903 | 984 |
There are 5 matching structural neighberhood comparisons for CATH ID 2.60.220.10.5.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1hn0A04 | 77.81 | 2.60.220.10 | 122 | 10 | 59 | 2.81 | 4.76 | |
![]() |
1zjaA03 | 77.07 | 2.60.40.1180 | 78 | 1 | 62 | 2.57 | 4.13 | |
![]() |
1uokA03 | 76.77 | 2.60.40.1180 | 78 | 1 | 62 | 2.14 | 3.44 | |
![]() |
1lwjA03 | 76.29 | 2.60.40.1180 | 50 | 16 | 58 | 2.81 | 4.80 | |
| 2qzuA02 | 73.19 | 3.30.1120.10 | 84 | 4 | 57 | 2.78 | 4.87 |
>pdb|1f1sA03 SFDKLANSKEVELLENSSKQQVIYDKNSQTWAVIKHDNQESLINNQFKMNKAGLYLVQKVGNDYQNVYYQPQTMTKTDQL AI
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"