Set cath from cathlist by auto on 05 Mar 2006 19:16
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1f0yA01 | 12 | 207 |
| 1f0yA02 | 211 | 297 |
There are 27 matching structural neighberhood comparisons for CATH ID 3.40.50.720.20.1.1.1.1 (SIMAX score < 5)
>pdb|1f0yA01 KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATS TDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEV IKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIV
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"