Classification merge by cuff on 12 Nov 2010 19:26
COMMENT: merge superfamilies FINAL: merge superfamilies 3.30.465.20 --> 3.30.465.10
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1f0xA01 | 269 | 310 |
| 1f0xA01 | 377 | 434 |
| 1f0xA02 | 9 | 105 |
| 1f0xA02 | 520 | 567 |
| 1f0xA03 | 106 | 268 |
| 1f0xA04 | 435 | 519 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1f0xA03 KLHVLGKGEQVLAYPGTTLYSLEKALKPLGREPHSVIGSSCIGASVIGGICNNSGGSLVQRGPAYTEMSLFARINEDGKL TLVNHLGIDLGETPEQILSKLDDDRIKDDDVRHDGRHAHDYDYVHRVRDIEADTPARYNADPDRLFESSGCAGKLAVFAV RLD
COMMENT: merge superfamilies FINAL: merge superfamilies 3.30.465.20 --> 3.30.465.10
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"