Set cath from cathlist by auto on 05 Mar 2006 19:22
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1f0kA01 | 7 | 162 |
| 1f0kA01 | 339 | 357 |
| 1f0kA02 | 163 | 338 |
There are 7 matching structural neighberhood comparisons for CATH ID 3.40.50.2000.11.1.1.1.1 (SIMAX score < 5)
>pdb|1f0kA02 VRTDVLALPLPQQRLAGREGPVRVLVVGGSQGARILNQTMPQVAAKLGDSVTIWHQSGKGSQQSVEQAYAEAGQPQHKVT EFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPFQHKDRQQYWNALPLEKAGAAKIIEQPQLSVDAVANTLAGW SRETLLTMAERARAAS
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"