Set cath from cathlist by auto on 05 Mar 2006 19:06
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1f0cA01 | 51 | 189 |
| 1f0cA01 | 294 | 337 |
| 1f0cA01 | 348 | 358 |
| 1f0cA02 | 190 | 293 |
| 1f0cA02 | 338 | 347 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1f0cA01 FISPPSISSVLTILYYGANGSTAEQLSKYVEDISFKSMNKVYGRYSAVFKDSFLRKIGDNFQTVDFTDCRTVDAINKCVD IFTEGKINPLLDEPLSPDTCLLAISAVYTGSYNLVDALVKLGLTEVFGSTGDYSNMCNSDVSVDAMIHKTYAAATCALVA DC
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"