CATH Domain: 1f06A02 XML data for domain: 1f06A02

Molscript image for 1f06A02
1f06A02
PDB coordinates for domain 1f06A02

PDB 1f06, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.360 Dihydrodipicolinate Reductase; domain 2
3.30.360.10 Dihydrodipicolinate Reductase; domain 2 Gene3D
3.30.360.10.14
3.30.360.10.14.1
3.30.360.10.14.1.1
3.30.360.10.14.1.1.1
3.30.360.10.14.1.1.1.1

[top]
Segment boundaries for domain 1f06A02

Chopping figure for domain 1f06A02
DomainStart PDB ResidueStop PDB Residue
1f06A01 1 123
1f06A01 267 311
1f06A02 127 264

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.360.10.14.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3bioA02 83.03 Diaminopimelate dehydrogenase [EC:1.4.1.16]Oxidoreductase, Gfo/Idh/MocA familyPorphyromonas gingivalisLysine biosynthesis 3.30.360.10 105 26 72 2.54 3.51
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1f06A02
NRVYAAAVLAEHQQHTFWGPGLSQGHSDALRRIPGVQKAVQYTLPSEDALEKARRGEAGDLTGKQTHKRQCFVVADAADH
ERIENDIRTMPDYFVGYEVEVNFIDEATFDSEHTGMPHGGHVITTGDTGGFNHTVEYI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1f06A02
NRVYAAAVLAEHQQHTFWGPGLSQGHSDALRRIPGVQKAVQYTLPSEDALEKARRGEAGDLTGKQTHKRQCFVVADAADH
ERIENDIRTMPDYFVGYEVEVNFIDEATFDSEHTGMPHGGHVITTGDTGGFNHTVEYI
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:30

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"