CATH Domain: 1eziA00 XML data for domain: 1eziA00

Molscript image for 1eziA00
1eziA00
PDB coordinates for domain 1eziA00

PDB 1ezi, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.550 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A
3.90.550.10 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Gene3D
3.90.550.10.17
3.90.550.10.17.1
3.90.550.10.17.1.1
3.90.550.10.17.1.1.1
3.90.550.10.17.1.1.1.1

[top]
Segment boundaries for domain 1eziA00

Chopping figure for domain 1eziA00
DomainStart PDB ResidueStop PDB Residue
1eziA00 2 224

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.90.550.10.17.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1qwjB00 85.51 Mus musculusN-acylneuraminate cytidylyltransferase 3.90.550.10 229 26 89 2.61 2.93
2px7A00 81.33 Terpenoid backbone biosynthesisMetabolic pathwaysThermus thermophilus HB82-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC:2.7.7.60]2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 3.90.550.10 203 15 82 3.17 3.84
1w55A01 80.81 Terpenoid backbone biosynthesis2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase / 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:2.7.7.60 4.6.1.12]Campylobacter jejuniBifunctional enzyme ispD/ispFProtein binding 3.90.550.10 207 12 88 3.54 4.02
2i5eA01 76.10 Methanosarcina mazeiPutative uncharacterized protein 3.90.550.10 162 11 63 3.18 4.97
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1eziA00
EKQNIAVILARQNSKGLPLKNLRKNGISLLGHTINAAISSKCFDRIIVSTDGGLIAEEAKNFGVEVVLRPAASSISGVIH
ALETIGSNSGTVTLLQPTSPLRTGAHIREAFSLFDEKIKGSVVSACPEHHPLKTLLQINEYAPRHLSDLEQPRQQLPQAF
RPNGAIYINDTASLIANNCFFIAPTKLYISHQDSIDIDTELDLQQAENILN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1eziA00
XEKQNIAVILARQNSKGLPLKNLRKXNGISLLGHTINAAISSKCFDRIIVSTDGGLIAEEAKNFGVEVVLRPAELASDTA
SSISGVIHALETIGSNSGTVTLLQPTSPLRTGAHIREAFSLFDEKIKGSVVSACPXEHHPLKTLLQINNGEYAPXRHLSD
LEQPRQQLPQAFRPNGAIYINDTASLIANNCFFIAPTKLYIXSHQDSIDIDTELDLQQAENILNHKES
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:35

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:35

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:59

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"