CATH Domain: 1ez0A02 XML data for domain: 1ez0A02

Molscript image for 1ez0A02
1ez0A02
PDB coordinates for domain 1ez0A02

PDB 1ez0, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.309 Aldehyde Dehydrogenase; Chain A, domain 2
3.40.309.10 Aldehyde Dehydrogenase; Chain A, domain 2 Gene3D
3.40.309.10.7
3.40.309.10.7.1
3.40.309.10.7.1.1
3.40.309.10.7.1.1.1
3.40.309.10.7.1.1.1.1

[top]
Segment boundaries for domain 1ez0A02

Chopping figure for domain 1ez0A02
DomainStart PDB ResidueStop PDB Residue
1ez0A01 5 254
1ez0A01 444 507
1ez0A02 256 440

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.40.309.10.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1t90A02 84.72 Methylmalonate semialdehyde dehydrogenase [acylating]Bacillus subtilisMethylmalonate-semialdehyde dehydrogenase [EC:1.2.1.27]Valine, leucine and isoleucine degradationPropanoate metabolism 3.40.309.10 199 14 87 2.21 2.53
1ad3A02 83.74 Tyrosine metabolismRattus norvegicusResponse to glucocorticoid stimulus3-chloroallyl aldehyde dehydrogenase activityCytosol 3.40.309.10 195 12 86 2.62 3.04
1o20A02 80.50 Thermotoga maritimaGamma-glutamyl phosphate reductaseArginine and proline metabolismGlutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]Metabolic pathways 3.40.309.10 149 11 74 3.58 4.80
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ez0A02
AINPTFIFPSAMRAKADLADQFVASMTMGCGQFCTKPGVVFALNTPETQAFIETAQSLIRQQSPSTLLTPGIRDSYQSQV
VSRGSDDGIDVTFSQAESPCVASALFVTSSENWRKHPAWEEEIFGPQSLIVVCENVADMLSLSEMLAGSLTATIHATEED
YPQVSQLIPRLEEIAGRLVFNGWPT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ez0A02
AINPTFIFPSAMRAKADLADQFVASMTMGCGQFCTKPGVVFALNTPETQAFIETAQSLIRQQSPSTLLTPGIRDSYQSQV
VSRGSDDGIDVTFSQAESPCVASALFVTSSENWRKHPAWEEEIFGPQSLIVVCENVADMLSLSEMLAGSLTATIHATEED
YPQVSQLIPRLEEIAGRLVFNGWPT
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:29

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"