CATH Domain: 1exzB00 XML data for domain: 1exzB00

Molscript image for 1exzB00
1exzB00
PDB coordinates for domain 1exzB00

PDB 1exz, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1250 Growth Hormone; Chain: A;
1.20.1250.10 Gene3D
1.20.1250.10.9
1.20.1250.10.9.1
1.20.1250.10.9.1.1
1.20.1250.10.9.1.1.1
1.20.1250.10.9.1.1.1.1

[top]
Segment boundaries for domain 1exzB00

Chopping figure for domain 1exzB00
DomainStart PDB ResidueStop PDB Residue
1exzB00 202 341

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.20.1250.10.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2gmfA00 78.38 Jak-STAT signaling pathwayPositive regulation of DNA replicationPositive regulation of tyrosine phosphorylation of Stat5 proteinHematopoietic cell lineageNegative regulation of cytolysis 1.20.1250.10 121 9 79 3.24 4.09
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1exzB00
GICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVN
IVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1exzB00
EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLV
NIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVS
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:21

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:21

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:42

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"