CATH Domain: 1ewqA02 XML data for domain: 1ewqA02

Molscript image for 1ewqA02
1ewqA02
PDB coordinates for domain 1ewqA02

PDB 1ewq, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.110 Gene3D
3.30.420.110.2
3.30.420.110.2.1
3.30.420.110.2.1.1
3.30.420.110.2.1.1.1
3.30.420.110.2.1.1.1.1

[top]
Segment boundaries for domain 1ewqA02

Chopping figure for domain 1ewqA02
DomainStart PDB ResidueStop PDB Residue
1ewqA01 2 126
1ewqA02 131 248
1ewqA03 249 368
1ewqA03 513 541
1ewqA04 375 510
1ewqA05 542 765

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.420.110.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vhxB00 78.75 Bacillus subtilisPutative holliday junction resolvase [EC:3.1.-.-]Putative Holliday junction resolvase 3.30.420.140 132 11 72 3.40 4.67
3bzcA03 78.56 Pseudomonas aeruginosaPutative uncharacterized protein 3.30.420.140 128 7 75 3.31 4.41
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ewqA02
ANYLAAIATGDGWGLAFLDVSTGEFKGTVLKSKSALYDELFRHRPAEVLLAPELLENGAFLDEFRKRFPVLSEAPFEPEG
EGPLALRRARGALLAYAQRTQGGALSLQPFRFYDPGA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ewqA02
ANYLAAIATGDGWGLAFLDVSTGEFKGTVLKSKSALYDELFRHRPAEVLLAPELLENGAFLDEFRKRFPVXLSEAPFEPE
GEGPLALRRARGALLAYAQRTQGGALSLQPFRFYDPGA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 06 Jan 2007 23:45

Assigning to "3.30.420.110" based on similarity with "1ewrA01"

Flow stage update by auto on 06 Jan 2007 23:40

No in_process hits for Domain "1ewqA02" ready to be processed

Flow stage update by auto on 06 Jan 2007 23:40

NW result present for Domain "1ewqA02"

Flow stage update by auto on 22 Dec 2006 19:34

All required files are present for Domain "1ewqA02"

Flow stage update by auto on 21 Dec 2006 19:37

Beginning processing for Domain "1ewqA02"

Insertion by cuff on 21 Dec 2006 17:29

checked choppings