CATH Domain: 1ewqA02 XML data for domain: 1ewqA02

Molscript image for 1ewqA02
1ewqA02
PDB coordinates for domain 1ewqA02

PDB 1ewq, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.110 Gene3D
3.30.420.110.1
3.30.420.110.1.1
3.30.420.110.1.1.1
3.30.420.110.1.1.1.1
3.30.420.110.1.1.1.1.1

[top]
Segment boundaries for domain 1ewqA02

Chopping figure for domain 1ewqA02
DomainStart PDB ResidueStop PDB Residue
1ewqA01 2 126
1ewqA02 131 248
1ewqA03 249 368
1ewqA03 513 541
1ewqA04 375 510
1ewqA05 542 765

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.420.110.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vhxB00 78.75 Bacillus subtilisPutative Holliday junction resolvasePutative holliday junction resolvase 3.30.420.140 132 11 72 3.40 4.67
3bzcA03 78.56 Pseudomonas aeruginosaPutative uncharacterized protein 3.30.420.140 128 7 75 3.31 4.41
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ewqA02
ANYLAAIATGDGWGLAFLDVSTGEFKGTVLKSKSALYDELFRHRPAEVLLAPELLENGAFLDEFRKRFPVLSEAPFEPEG
EGPLALRRARGALLAYAQRTQGGALSLQPFRFYDPGA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ewqA02
ANYLAAIATGDGWGLAFLDVSTGEFKGTVLKSKSALYDELFRHRPAEVLLAPELLENGAFLDEFRKRFPVXLSEAPFEPE
GEGPLALRRARGALLAYAQRTQGGALSLQPFRFYDPGA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 06 Jan 2007 23:45

Assigning to "3.30.420.110" based on similarity with "1ewrA01"

Flow stage update by auto on 06 Jan 2007 23:40

No in_process hits for Domain "1ewqA02" ready to be processed

Flow stage update by auto on 06 Jan 2007 23:40

NW result present for Domain "1ewqA02"

Flow stage update by auto on 22 Dec 2006 19:34

All required files are present for Domain "1ewqA02"

Flow stage update by auto on 21 Dec 2006 19:37

Beginning processing for Domain "1ewqA02"

Insertion by cuff on 21 Dec 2006 17:29

checked choppings