CATH Domain: 1evlA01 XML data for domain: 1evlA01

Molscript image for 1evlA01
1evlA01
PDB coordinates for domain 1evlA01

PDB 1evl, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.930 BirA Bifunctional Protein; domain 2
3.30.930.10 Bira Bifunctional Protein; Domain 2 Gene3D
3.30.930.10.1
3.30.930.10.1.1
3.30.930.10.1.1.1
3.30.930.10.1.1.1.1
3.30.930.10.1.1.1.1.1

[top]
Segment boundaries for domain 1evlA01

Chopping figure for domain 1evlA01
DomainStart PDB ResidueStop PDB Residue
1evlA01 242 530
1evlA02 531 642

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.30.930.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3ialA01 84.58 Aminoacyl-tRNA biosynthesisProlyl-tRNA synthetase [EC:6.1.1.15]Giardia lamblia ATCC 50803Prolyl-tRNA synthetase 3.30.930.10 280 13 86 2.06 2.37
1hc7A01 83.38 Aminoacyl-tRNA biosynthesisThermus thermophilus HB8Prolyl-tRNA synthetase [EC:6.1.1.15]Prolyl-tRNA synthetase 3.30.930.10 269 13 83 2.21 2.65
1kmmA01 82.15 Aminoacyl-tRNA biosynthesisHistidyl-tRNA synthetaseHistidyl-tRNA synthetase [EC:6.1.1.21]Escherichia coli K-12 3.30.930.10 287 14 87 3.41 3.88
2zt5A01 81.76 Glycine-tRNA ligase activitySoluble fractionProtein dimerization activityHomo sapiensGlycyl-tRNA synthetase 3.30.930.10 325 16 75 2.08 2.75
1wleA02 81.64 Aminoacyl-tRNA biosynthesisATP bindingBos taurusSeryl-tRNA aminoacylationSeryl-tRNA synthetase, mitochondrial 3.30.930.10 317 15 80 2.25 2.81
1atiB01 81.43 Aminoacyl-tRNA biosynthesisThermus thermophilus HB8Glycyl-tRNA synthetase [EC:6.1.1.14]Glycine-tRNA ligase activityProtein dimerization activity 3.30.930.10 305 12 82 2.46 2.99
1g5hA01 80.00 Mus musculusIdentical protein bindingDNA-directed DNA polymerase activityDNA polymerase subunit gamma-2, mitochondrialMitochondrion 3.30.930.10 287 7 80 3.39 4.19
2q7eA02 75.20 Aminoacyl-tRNA biosynthesisMethanosarcina mazeiPyrrolysyl-tRNA synthetasePyrrolysyl-tRNA synthetase [EC:6.1.1.26] 3.30.930.10 208 12 65 2.98 4.56
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1evlA01
RDHRKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTTS
SENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGSLHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCI
RLVYDMYSTFGFEKIVVKLSTRPEKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQCG
TVQLDFSLPSRLSASYVGEDNERKVPVMIHRAILGSMERFIGILTEEFA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1evlA01
RDHRKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTTS
SENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGSLHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCI
RLVYDMYSTFGFEKIVVKLSTRPEKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQCG
TVQLDFSLPSRLSASYVGEDNERKVPVMIHRAILGSMERFIGILTEEFA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:29

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"