Set cath from cathlist by auto on 05 Mar 2006 19:26
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1euhA01 | 2 | 251 |
| 1euhA01 | 451 | 474 |
| 1euhA02 | 254 | 446 |
There are 7 matching structural neighberhood comparisons for CATH ID 3.40.309.10.4.1.1.1.1 (SIMAX score < 5)
>pdb|1euhA02 KDSAIVLEDADLELTAKNIIAGAFGYSGQRCTAVKRVLVMESVADELVEKIREKVLALTIGNPEDDADITPLIDTKSADY VEGLINDANDKGATALTEIKREGNLICPILFDKVTTDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTND FPRAFGIAEQLEVGTVHINNKTQRGTDNFPFLG
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"