CATH Domain: 1euhA02 XML data for domain: 1euhA02

Molscript image for 1euhA02
1euhA02
PDB coordinates for domain 1euhA02

PDB 1euh, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.309 Aldehyde Dehydrogenase; Chain A, domain 2
3.40.309.10 Aldehyde Dehydrogenase; Chain A, domain 2 Gene3D
3.40.309.10.4
3.40.309.10.4.1
3.40.309.10.4.1.1
3.40.309.10.4.1.1.1
3.40.309.10.4.1.1.1.1

[top]
Segment boundaries for domain 1euhA02

Chopping figure for domain 1euhA02
DomainStart PDB ResidueStop PDB Residue
1euhA01 2 251
1euhA01 451 474
1euhA02 254 446

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.40.309.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wndA02 91.20 Arginine and proline metabolismBeta-Alanine metabolismGamma-aminobutyraldehyde dehydrogenaseAminobutyraldehyde dehydrogenase [EC:1.2.1.19]Escherichia coli K-12 3.40.309.10 191 27 95 1.32 1.38
1t90A02 91.06 Methylmalonate semialdehyde dehydrogenase [acylating]Bacillus subtilisMethylmalonate-semialdehyde dehydrogenase [EC:1.2.1.27]Valine, leucine and isoleucine degradationPropanoate metabolism 3.40.309.10 199 37 96 1.58 1.64
3k2wB02 90.89 Betaine-aldehyde dehydrogenaseLactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]Pseudoalteromonas atlantica T6cPyruvate metabolismGlyoxylate and dicarboxylate metabolism 3.40.309.10 194 34 95 1.44 1.51
1ad3A02 88.30 Tyrosine metabolismRattus norvegicusResponse to glucocorticoid stimulus3-chloroallyl aldehyde dehydrogenase activityCytosol 3.40.309.10 195 26 96 2.58 2.68
1ez0A02 85.78 NADP-dependent fatty aldehyde dehydrogenaseVibrio harveyi 3.40.309.10 185 16 89 2.35 2.62
1o20A02 83.29 Thermotoga maritimaGamma-glutamyl phosphate reductaseArginine and proline metabolismGlutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]Metabolic pathways 3.40.309.10 149 22 70 2.17 3.06
1kaeA01 77.67 Histidine metabolismMetabolic pathwaysHistidinol dehydrogenaseHistidine biosynthetic processHistidinol dehydrogenase [EC:1.1.1.23] 3.40.50.1980 155 12 64 3.11 4.84
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1euhA02
KDSAIVLEDADLELTAKNIIAGAFGYSGQRCTAVKRVLVMESVADELVEKIREKVLALTIGNPEDDADITPLIDTKSADY
VEGLINDANDKGATALTEIKREGNLICPILFDKVTTDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTND
FPRAFGIAEQLEVGTVHINNKTQRGTDNFPFLG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1euhA02
KDSAIVLEDADLELTAKNIIAGAFGYSGQRCTAVKRVLVMESVADELVEKIREKVLALTIGNPEDDADITPLIDTKSADY
VEGLINDANDKGATALTEIKREGNLICPILFDKVTTDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTND
FPRAFGIAEQLEVGTVHINNKTQRGTDNFPFLG
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:29

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"