CATH Domain: 1euhA01 XML data for domain: 1euhA01

Molscript image for 1euhA01
1euhA01
PDB coordinates for domain 1euhA01

PDB 1euh, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.605 Aldehyde Dehydrogenase; Chain A, domain 1
3.40.605.10 Aldehyde Dehydrogenase; Chain A, domain 1 Gene3D
3.40.605.10.6
3.40.605.10.6.1
3.40.605.10.6.1.1
3.40.605.10.6.1.1.1
3.40.605.10.6.1.1.1.1

[top]
Segment boundaries for domain 1euhA01

Chopping figure for domain 1euhA01
DomainStart PDB ResidueStop PDB Residue
1euhA01 2 251
1euhA01 451 474
1euhA02 254 446

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.40.605.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2w8nA01 89.84 Succinate-semialdehyde dehydrogenase activitySoluble fractionGamma-aminobutyric acid catabolic processCentral nervous system developmentMetabolic pathways 3.40.605.10 289 30 93 1.65 1.77
1uxtA01 89.38 Thermoproteus tenaxGlyceraldehyde-3-phosphate dehydrogenase (NADP+) 3.40.605.10 273 31 99 1.59 1.60
1t90A01 88.64 Methylmalonate semialdehyde dehydrogenase [acylating]Bacillus subtilisMethylmalonate-semialdehyde dehydrogenase [EC:1.2.1.27]Valine, leucine and isoleucine degradationPropanoate metabolism 3.40.605.10 280 29 95 1.74 1.82
1a4sA01 87.37 Betaine aldehyde dehydrogenaseGadus callarias 3.40.605.10 260 28 89 1.67 1.88
1ez0B01 85.09 NADP-dependent fatty aldehyde dehydrogenaseVibrio harveyi 3.40.605.10 312 21 82 2.34 2.83
1ad3A01 82.82 Tyrosine metabolismRattus norvegicusResponse to glucocorticoid stimulus3-chloroallyl aldehyde dehydrogenase activityCytosol 3.40.605.10 247 21 83 2.29 2.75
1o20A01 81.74 Thermotoga maritimaGamma-glutamyl phosphate reductaseArginine and proline metabolismGlutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]Metabolic pathways 3.40.605.10 263 12 82 2.99 3.64
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1euhA01
TKQYKNYVNGEWKLSENEIKIYEPASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKVADILMRDKEK
IGAILSKEVAKGYKSAVSEVVRTAEIINYAAEEGLRMEGEVLEGGSFEAASKKKIAVVRREPVGLVLAISPFNYPVNLAG
SKIAPALIAGNVIAFKPPTQGSISGLLLAEAFAEAGLPAGVFNTITGRGSEIGDYIVEHQAVNFINFTGSTGIGERIGKM
AGMRPIMLELGAGIQGVKYSIEAMTTVKSVVFDI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1euhA01
MTKQYKNYVNGEWKLSENEIKIYEPASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKVADILMRDKE
KIGAILSKEVAKGYKSAVSEVVRTAEIINYAAEEGLRMEGEVLEGGSFEAASKKKIAVVRREPVGLVLAISPFNYPVNLA
GSKIAPALIAGNVIAFKPPTQGSISGLLLAEAFAEAGLPAGVFNTITGRGSEIGDYIVEHQAVNFINFTGSTGIGERIGK
MAGMRPIMLELGAGIQGVKYSIEAMTTVKSVVFDI
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:27

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:27

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:29

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"