Set cath from cathlist by auto on 05 Mar 2006 19:32
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1eq2D01 | 1 | 167 |
| 1eq2D01 | 214 | 236 |
| 1eq2D01 | 280 | 292 |
| 1eq2D02 | 168 | 213 |
| 1eq2D02 | 237 | 279 |
| 1eq2D02 | 293 | 304 |
There are 4 matching structural neighberhood comparisons for CATH ID 3.90.25.10.13.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1oc2A02 | 78.89 | 3.90.25.10 | 77 | 12 | 54 | 1.71 | 3.14 | |
![]() |
1bxkA02 | 77.53 | 3.90.25.10 | 89 | 5 | 54 | 2.18 | 4.00 | |
![]() |
1n2sA02 | 77.23 | 3.90.25.10 | 85 | 4 | 69 | 3.23 | 4.66 | |
![]() |
1rkxB02 | 76.56 | 3.90.25.10 | 154 | 6 | 53 | 1.98 | 3.67 |
>pdb|1eq2D02 FNVYGPREGHKGSMASVAFHLNTQLNNGESPKLFEGSENFKRDFVYTGRAESFQAVADATLAYHKKGQIEYIPFPDKLKG RYQAFTQADKTVAEGVTEYMA
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"