Set cath from cathlist by auto on 05 Mar 2006 19:12
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ep3B01 | 2 | 100 |
| 1ep3B02 | 104 | 220 |
| 1ep3B03 | 221 | 262 |
There are 70 matching structural neighberhood comparisons for CATH ID 3.40.50.80.13.1.1.1.1 (SIMAX score < 5)
>pdb|1ep3B02 VAEVTSTDKILIIGGGIGVPPLYELAKQLEKTGCQMTILLGFASENVKILENEFSNLKNVTLKIATDDGSYGTKGHVGML MNEIDFEVDALYTCGAPAMLKAVAKKYDQLERLYISM
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"