CATH Domain: 1eoqA00 XML data for domain: 1eoqA00

Molscript image for 1eoqA00
1eoqA00
PDB coordinates for domain 1eoqA00

PDB 1eoq, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1200 Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A
1.10.1200.30 Gene3D
1.10.1200.30.1
1.10.1200.30.1.1
1.10.1200.30.1.1.2
1.10.1200.30.1.1.2.2
1.10.1200.30.1.1.2.2.1

[top]
Segment boundaries for domain 1eoqA00

Chopping figure for domain 1eoqA00
DomainStart PDB ResidueStop PDB Residue
1eoqA00 154 230

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.10.1200.30.1.1.2.2.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1eiaA02 88.32 Gag polyproteinEquine infectious anemia virus (ISOLATE WYOMING) 1.10.1200.30 74 17 96 2.72 2.83
1qrjB02 86.48 Gag-Pro-Pol polyproteinHuman T-cell lymphotrophic virus type 1 (strain ATK) 1.10.1200.30 81 19 90 2.49 2.76
1a8oA00 85.13 Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE)Gag-Pol polyprotein 1.10.1200.30 66 18 85 2.50 2.92
1vhnA02 75.18 Thermotoga maritimaPutative uncharacterized protein 1.10.1200.80 68 5 78 3.57 4.52
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1eoqA00
MDIMQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQKTAP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1eoqA00
MDIMQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQKTAP
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:38

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"