CATH Domain: 1em9B00 XML data for domain: 1em9B00

Molscript image for 1em9B00
1em9B00
PDB coordinates for domain 1em9B00

PDB 1em9, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.375 Human Immunodeficiency Virus Type 1 Capsid Protein
1.10.375.10 Human Immunodeficiency Virus Type 1 Capsid Protein Gene3D
1.10.375.10.3
1.10.375.10.3.1
1.10.375.10.3.1.1
1.10.375.10.3.1.1.1
1.10.375.10.3.1.1.1.1

[top]
Segment boundaries for domain 1em9B00

Chopping figure for domain 1em9B00
DomainStart PDB ResidueStop PDB Residue
1em9B00 1 147

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.375.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1p7nA00 89.86 Rous sarcoma virus - Prague CGag polyprotein 1.10.375.10 176 96 80 2.95 3.68
1h5wB01 70.26 Bacillus phage phi29Upper collar protein 1.10.246.30 72 5 29 1.21 4.16
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1em9B00
PVVIKPAWTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTVIAA
ATRDPRHPANGQERTNLNRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1em9B00
PVVIKTEGPAWTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTV
IAAATRDPRHPANGQGRGERTNLNRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLAEPAGPWA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:27

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"