Set cath from cathlist by auto on 05 Mar 2006 18:28
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1elvA01 | 437 | 532 |
| 1elvA01 | 656 | 664 |
| 1elvA02 | 423 | 436 |
| 1elvA02 | 534 | 655 |
| 1elvA03 | 342 | 409 |
There are 7 matching structural neighberhood comparisons for CATH ID 2.40.10.10.56.1.1.1.1 (SIMAX score < 5)
>pdb|1elvA02 IIGGSDADIKNFPWCLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVAYVFTPNMICAGGEKG MDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCGTYGLYTRVKN
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"