CATH Domain: 1eluA02 XML data for domain: 1eluA02

Molscript image for 1eluA02
1eluA02
PDB coordinates for domain 1eluA02

PDB 1elu, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.640 Aspartate Aminotransferase; domain 2
3.40.640.10 Type I PLP-dependent aspartate aminotransferase-like (Major domain) Gene3D
3.40.640.10.8
3.40.640.10.8.1
3.40.640.10.8.1.1
3.40.640.10.8.1.1.1
3.40.640.10.8.1.1.1.1

Segment boundaries for domain 1eluA02

Chopping figure for domain 1eluA02
DomainStart PDB ResidueStop PDB Residue
1eluA01 13 31
1eluA01 296 391
1eluA02 32 295

Structural Neighbourhood (25 entries)

There are 25 matching structural neighberhood comparisons for CATH ID 3.40.640.10.8.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 25 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1t3iB02 88.83 Probable cysteine desulfuraseSelenoamino acid metabolismSelenocysteine lyaseSynechocystis sp. PCC 6803 3.40.640.10 258 26 96 2.51 2.61
1p3wA02 86.31 Thiamine metabolismCysteine desulfuraseCysteine desulfuraseEscherichia coli K12Protein binding 3.40.640.10 247 22 91 2.90 3.18
2yrrA02 82.99 Thermus thermophilus HB8Aminotransferase, class V 3.40.640.10 241 15 87 3.22 3.66
1bs0A02 82.46 Biotin metabolism8-amino-7-oxononanoate synthaseEscherichia coli K12 3.40.640.10 228 15 82 3.88 4.72
2hufA02 82.25 Alanine glyoxylate aminotransferaseAedes aegypti 3.40.640.10 248 15 87 3.31 3.78
1m32A02 81.09 2-aminoethylphosphonate--pyruvate transaminaseAminophosphonate metabolism2-aminoethylphosphonate-pyruvate transaminaseSalmonella typhimurium 3.40.640.10 237 16 83 3.34 3.99
1xi9A02 80.97 Tyrosine metabolismPyrococcus furiosusCysteine metabolismArginine and proline metabolismCarbon fixation 3.40.640.10 242 14 82 3.20 3.88
1mdoA01 79.85 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferaseUDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferaseTwo-component system - GeneralNucleotide sugars metabolismSalmonella typhimurium 3.40.640.10 226 16 80 3.76 4.68
1jg8A01 79.80 Thermotoga maritimaGlycine, serine and threonine metabolismThreonine aldolaseL-allo-threonine aldolase 3.40.640.10 245 15 79 3.15 3.98
3dydA02 79.43 Tyrosine metabolismTyrosine aminotransferasePhenylalanine metabolismTyrosine aminotransferaseNovobiocin biosynthesis 3.40.640.10 244 13 83 3.46 4.13
1d2fA02 79.34 Nitrogen metabolismCysteine metabolismSelenoamino acid metabolismSulfur metabolismMethionine metabolism 3.40.640.10 243 14 83 3.14 3.75
1o4sA02 79.19 Tyrosine metabolismThermotoga maritimaArginine and proline metabolismCysteine metabolismCarbon fixation 3.40.640.10 221 14 77 3.53 4.57
2ez2A02 78.95 Citrobacter freundiiTyrosine phenol-lyase 3.40.640.10 253 9 81 3.33 4.11
1lc5A02 78.95 Threonine-phosphate decarboxylasePorphyrin and chlorophyll metabolismSalmonella enterica subsp. enterica serovar Paratyphi B str. SPB7Putative uncharacterized protein 3.40.640.10 225 15 79 3.02 3.78
1gd9A02 78.89 Tyrosine metabolismArginine and proline metabolismCysteine metabolismPyrococcus horikoshiiCarbon fixation 3.40.640.10 223 16 77 3.41 4.41
2ogaA01 78.57 Streptomyces venezuelaeTransaminase 3.40.640.10 240 14 82 3.79 4.61
2gsaA02 78.40 Glutamate-1-semialdehyde 2,1-aminomutasePorphyrin and chlorophyll metabolismGlutamate-1-semialdehyde 2,1-aminomutaseSynechococcus elongatus PCC 6301 3.40.640.10 249 10 82 4.01 4.83
3b8xA01 78.08 Putative pyridoxamine 5-phosphate-dependent dehydraseEscherichia coli 3.40.640.10 258 12 85 4.02 4.72
2qmaA03 77.92 Vibrio parahaemolyticusDiaminobutyrate-2-oxoglutarate transaminaseGlycine, serine and threonine metabolismDiaminobutyrate-pyruvate transaminase & L-2,4-diaminobutyrate decarboxylase 3.40.640.10 238 10 78 3.91 4.96
1fg7A01 77.81 Tyrosine metabolismNovobiocin biosynthesisPhenylalanine, tyrosine and tryptophan biosynthesisHistidine metabolismPhenylalanine metabolism 3.40.640.10 203 12 74 3.42 4.58
1s0aA02 77.68 Biotin metabolismAdenosylmethionine-8-amino-7-oxononanoate aminotransferaseAdenosylmethionine-8-amino-7-oxononanoate aminotransferaseEscherichia coli K12 3.40.640.10 268 8 82 3.80 4.61
1c7nA02 77.30 Treponema denticolaHemolysin 3.40.640.10 225 7 76 3.18 4.14
1svvA01 76.93 Leishmania major strain FriedlinGlycine, serine and threonine metabolismThreonine aldolasePutative uncharacterized protein 3.40.640.10 242 13 80 3.68 4.58
1ajsB02 76.24 Tyrosine metabolismArginine and proline metabolismCysteine metabolismSus scrofaAspartate aminotransferase, cytoplasmic 3.40.640.10 278 10 80 3.90 4.82
1uu1A02 75.99 Histidinol-phosphate aminotransferaseTyrosine metabolismThermotoga maritimaNovobiocin biosynthesisPhenylalanine, tyrosine and tryptophan biosynthesis 3.40.640.10 203 10 74 3.53 4.75
Displaying entries 1 to 25 (page 1 of 1)


Domain ATOM Sequence

>pdb|1eluA02
PTVALEAITAMYGYLQENGPFSIAANQHIQQLIAQLRQALAETFNVDPNTITITDNVTTGCDIVLWGLDWHQGDEILLTD
CEHPGIIAIVQAIAARFGITYRFFPVAATLNQGDAAAVLANHLGPKTRLVILSHLLWNTGQVLPLAEIMAVCRRHQGNYP
VRVLVDGAQSAGSLPLDFSRLEVDYYAFTGHKWFAGPAGVGGLYIHGDCLGEINPTYVGWRSITYGAKGEPTGWAEGGKR
FEVATSAYPQYAGLLAALQLHQRQ    

Domain COMBS Sequence

>pdb|1eluA02
PTVALEAITAMYGYLQENGPFSIAANQHIQQLIAQLRQALAETFNVDPNTITITDNVTTGCDIVLWGLDWHQGDEILLTD
CEHPGIIAIVQAIAARFGITYRFFPVAATLNQGDAAAVLANHLGPKTRLVILSHLLWNTGQVLPLAEIMAVCRRHQGNYP
VRVLVDGAQSAGSLPLDFSRLEVDYYAFTGHKWFAGPAGVGGLYIHGDCLGEINPTYVGWRSITYGAKGEPTGWAEGGKR
FEVATSAYPQYAGLLAALQLHQRQ    

Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:27

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:27

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:28

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"