Set cath from cathlist by auto on 05 Mar 2006 19:36
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1eluA01 | 13 | 31 |
| 1eluA01 | 296 | 391 |
| 1eluA02 | 32 | 295 |
There are 15 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.18.1.1.1.1 (SIMAX score < 5)
>pdb|1eluA01 QFPGLANKTYFNFGGQGILGTAEERYQAICQRSEFLWRGLNQLPHVHCLATSAPQAGLVSFTVDSPLGHRAIVQKLEEQR IYLRTIADPDCIRACCHYITDEEEINHLLARLADF
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"