CATH Domain: 1eluA01 XML data for domain: 1eluA01

Molscript image for 1eluA01
1eluA01
PDB coordinates for domain 1eluA01

PDB 1elu, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1150 Aspartate Aminotransferase, domain 1
3.90.1150.10 Aspartate Aminotransferase, domain 1 Gene3D
3.90.1150.10.18
3.90.1150.10.18.1
3.90.1150.10.18.1.1
3.90.1150.10.18.1.1.1
3.90.1150.10.18.1.1.1.1

[top]
Segment boundaries for domain 1eluA01

Chopping figure for domain 1eluA01
DomainStart PDB ResidueStop PDB Residue
1eluA01 13 31
1eluA01 296 391
1eluA02 32 295

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.18.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1eg5B01 87.25 Thermotoga maritimaThiamine metabolismCysteine desulfurase [EC:2.8.1.7]Aminotransferase, class V 3.90.1150.10 106 16 82 2.15 2.60
1p3wA01 86.61 Thiamine metabolismCysteine desulfurase activitySelenocysteine lyase activityCysteine desulfuraseIron-sulfur cluster assembly 3.90.1150.10 121 12 85 2.30 2.68
1m32A01 85.95 2-aminoethylphosphonate--pyruvate transaminaseSalmonella enterica subsp. enterica serovar Typhimurium2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]Phosphonate and phosphinate metabolismMetabolic pathways 3.90.1150.10 110 17 91 2.13 2.33
1jg8A02 85.67 Thermotoga maritimaThreonine aldolase [EC:4.1.2.5]Glycine, serine and threonine metabolismMetabolic pathwaysL-allo-threonine aldolase 3.90.1150.10 96 12 79 1.97 2.49
3k40A03 84.69 Aromatic-L-amino-acid decarboxylase activityDopamine biosynthetic process from tyrosineAromatic-L-amino-acid decarboxylaseDevelopmental pigmentationSerotonin biosynthetic process from tryptophan 3.90.1150.10 99 12 74 2.25 3.01
3ftbA01 84.37 Tyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathwaysPhenylalanine metabolism 3.90.1150.10 112 14 87 3.39 3.86
1fc4A02 84.04 Glycine, serine and threonine metabolismLigase activityMetal ion binding2-amino-3-ketobutyrate coenzyme A ligaseGlycine C-acetyltransferase [EC:2.3.1.29] 3.90.1150.10 133 7 77 3.59 4.64
1uu2B01 83.68 Thermotoga maritimaTyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.90.1150.10 117 15 87 3.57 4.09
2qmaA02 83.46 Diaminobutyrate-2-oxoglutarate transaminase [EC:2.6.1.76]Vibrio parahaemolyticusGlycine, serine and threonine metabolismDiaminobutyrate-pyruvate transaminase & L-2,4-diaminobutyrate decarboxylaseMetabolic pathways 3.90.1150.10 122 9 86 2.76 3.21
1iugA01 83.40 Thermus thermophilusAspartate aminotransferase 3.90.1150.10 111 8 89 2.22 2.48
1svvB02 83.22 Leishmania major strain FriedlinThreonine aldolase [EC:4.1.2.5]Glycine, serine and threonine metabolismMetabolic pathwaysPutative uncharacterized protein 3.90.1150.10 88 15 72 2.45 3.39
1d2fB01 78.81 Nitrogen metabolismSelenoamino acid metabolismSulfur metabolismMetabolic pathwaysCysteine and methionine metabolism 3.90.1150.10 124 6 86 3.74 4.33
1rv3A01 77.60 Oryctolagus cuniculusSerine hydroxymethyltransferase, cytosolic 3.90.1150.10 170 7 59 2.96 4.98
1tplA01 76.52 Citrobacter freundiiTyrosine phenol-lyase 3.90.1150.10 181 5 61 3.07 4.96
1c7nA01 74.34 Treponema denticolaHemolysin 3.90.1150.10 164 9 65 3.20 4.86
[1]
Displaying entries 1 to 15 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1eluA01
QFPGLANKTYFNFGGQGILGTAEERYQAICQRSEFLWRGLNQLPHVHCLATSAPQAGLVSFTVDSPLGHRAIVQKLEEQR
IYLRTIADPDCIRACCHYITDEEEINHLLARLADF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1eluA01
MTMITPSLHQFPGLANKTYFNFGGQGILGTAEERYQAICQRSEFLWRGLNQLPHVHCLATSAPQAGLVSFTVDSPLGHRA
IVQKLEEQRIYLRTIADPDCIRACCHYITDEEEINHLLARLADF
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:36

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:36

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:28

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"