CATH Domain: 1ekeB02 XML data for domain: 1ekeB02

Molscript image for 1ekeB02
1ekeB02
PDB coordinates for domain 1ekeB02

PDB 1eke, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.10 Arc Repressor Mutant, subunit A
1.10.10.460 Ribonuclease hii. Domain 2 Gene3D
1.10.10.460.1
1.10.10.460.1.1
1.10.10.460.1.1.1
1.10.10.460.1.1.1.1
1.10.10.460.1.1.1.1.1

[top]
Segment boundaries for domain 1ekeB02

Chopping figure for domain 1ekeB02
DomainStart PDB ResidueStop PDB Residue
1ekeB01 2 175
1ekeB02 176 222

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.10.460.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1io2A02 94.67 DNA replicationRibonuclease HIIThermococcus kodakarensisRibonuclease HII [EC:3.1.26.4] 1.10.10.460 47 55 100 1.35 1.35
1m1eB01 80.89 Wnt signaling pathwayBeta-catenin-interacting protein 1 (Inhibitor of beta-catenin and Tcf-4)Homo sapiensBeta-catenin-interacting protein 1Signal transduction 1.10.10.490 46 13 82 4.00 4.82
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ekeB02
IYGDIGSGYPSDPKTIKFLEDYFKKHKKLPDIARTHWKTCKRILDKS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ekeB02
IYGDIGSGYPSDPKTIKFLEDYFKKHKKLPDIARTHWKTCKRILDKS
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 17:55

Assigning to "1.10.10.460" based on similarity with "1ekeA02" (NWSI: 100, NWO: 100, SPS: 96.25, SPO: 94, RMSD: 0.49)

Flow stage update by auto on 28 Apr 2006 17:49

NW result present for Domain "1ekeB02"

Flow stage update by auto on 28 Apr 2006 17:42

All required files are present for Domain "1ekeB02"

Flow stage update by auto on 27 Apr 2006 17:30

Beginning processing for Domain "1ekeB02"

Insertion by auto on 05 Mar 2006 16:27

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"