Set cath from cathlist by auto on 05 Mar 2006 18:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ejxC01 | 1002 | 1128 |
| 1ejxC01 | 1423 | 1480 |
| 1ejxC02 | 1129 | 1422 |
| 1ejxC02 | 1481 | 1565 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1ejxC01 SNISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQMLAADCVDLVLTNALIVDHWGI VKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIAAEGKIVTASIEVGKLADLVVWSPAFFGVKPATVIKGGMIAI APMGDINASIPTPQPVHYRPMFGAL
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"