Set cath from cathlist by auto on 05 Mar 2006 19:31
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ejdA01 | 1 | 18 |
| 1ejdA01 | 230 | 418 |
| 1ejdA02 | 21 | 228 |
There are 2 matching structural neighberhood comparisons for CATH ID 3.65.10.10.4.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2pqcA02 | 84.18 | 3.65.10.10 | 214 | 15 | 92 | 2.80 | 3.04 | |
![]() |
2pqcA01 | 77.47 | 3.65.10.10 | 231 | 14 | 81 | 3.62 | 4.45 |
>pdb|1ejdA02 AKNAALPILFAALLAEEPVEIQNVPKLKDIDTTMKLLTQLGTKVERDGSVWIDASNVNNFSAPYDLVKTMRASIWALGPL VARFGQGQVSLPGGCAIGARPVDLHIFGLEKLGAEIKLEEGYVKASVNGRLKGAHIVMDKVSVGATVTIMSAATLAEGTT IIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVERLGGGVYRV
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"