CATH Domain: 1eiaA02 XML data for domain: 1eiaA02

Molscript image for 1eiaA02
1eiaA02
PDB coordinates for domain 1eiaA02

PDB 1eia, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1200 Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A
1.10.1200.30 Gene3D
1.10.1200.30.3
1.10.1200.30.3.1
1.10.1200.30.3.1.1
1.10.1200.30.3.1.1.1
1.10.1200.30.3.1.1.1.1

[top]
Segment boundaries for domain 1eiaA02

Chopping figure for domain 1eiaA02
DomainStart PDB ResidueStop PDB Residue
1eiaA01 16 148
1eiaA02 149 222

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.1200.30.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1qrjB02 86.04 Gag-Pro-Pol polyproteinHuman T-cell lymphotrophic virus type 1 (strain ATK) 1.10.1200.30 81 25 90 2.45 2.72
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1eiaA02
KAQNIRQGAKEPYPEFVDRLLSQIKSEGHPQEISKFLTDTLTIQNANEECRNAMRHLRPEDTLEEKMYACRDIG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1eiaA02
KAQNIRQGAKEPYPEFVDRLLSQIKSEGHPQEISKFLTDTLTIQNANEECRNAMRHLRPEDTLEEKMYACRDIG
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1eia002" to "1eiaA02" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:27

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"