CATH Domain: 1eiaA01 XML data for domain: 1eiaA01

Molscript image for 1eiaA01
1eiaA01
PDB coordinates for domain 1eiaA01

PDB 1eia, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.375 Human Immunodeficiency Virus Type 1 Capsid Protein
1.10.375.10 Human Immunodeficiency Virus Type 1 Capsid Protein Gene3D
1.10.375.10.4
1.10.375.10.4.1
1.10.375.10.4.1.1
1.10.375.10.4.1.1.1
1.10.375.10.4.1.1.1.1

[top]
Segment boundaries for domain 1eiaA01

Chopping figure for domain 1eiaA01
DomainStart PDB ResidueStop PDB Residue
1eiaA01 16 148
1eiaA02 149 222

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1eiaA01
TPRGYTTWVNTIQTNGLLNEASQNLFGILSVDCTSEEMNAFLDVVPGQAGQKQILLDAIDKIADDWDNRHPLPNAPLVAP
PQGPIPMTARFIRGLGVPRERQMEPAFDQFRQTYRQWIIEAMSEGIKVMIGKP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1eiaA01
TPRGYTTWVNTIQTNGLLNEASQNLFGILSVDCTSEEMNAFLDVVPGQAGQKQILLDAIDKIADDWDNRHPLPNAPLVAP
PQGPIPMTARFIRGLGVPRERQMEPAFDQFRQTYRQWIIEAMSEGIKVMIGKP
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1eia001" to "1eiaA01" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:27

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"