CATH Domain: 1ehiA02 XML data for domain: 1ehiA02

Molscript image for 1ehiA02
1ehiA02
PDB coordinates for domain 1ehiA02

PDB 1ehi, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.470 D-amino Acid Aminotransferase; Chain A, domain 1
3.30.470.20 ATP-grasp fold, B domain Gene3D
3.30.470.20.12
3.30.470.20.12.1
3.30.470.20.12.1.1
3.30.470.20.12.1.1.1
3.30.470.20.12.1.1.1.1

[top]
Segment boundaries for domain 1ehiA02

Chopping figure for domain 1ehiA02
DomainStart PDB ResidueStop PDB Residue
1ehiA01 3 122
1ehiA02 219 362
1ehiA03 151 218

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.470.20.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gsaA02 75.35 Glutathione metabolismMetabolic pathwaysGlutathione synthase [EC:6.3.2.3]Protein bindingEscherichia coli K-12 3.30.470.20 121 9 65 3.17 4.86
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ehiA02
VNGARELEVGVIGNDQPLVSEIGAHTVPNQGSGDGWYDYNNKFVDNSAVHFQIPAQLSPEVTKEVKQMALDAYKVLNLRG
EARMDFLLDENNVPYLGEPNTLPGFTNMSLFKRLWDYSDINNAKLVDMLIDYGFEDFAQNKKLS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ehiA02
VNGARELEVGVIGNDQPLVSEIGAHTVPNQGSGDGWYDYNNKFVDNSAVHFQIPAQLSPEVTKEVKQMALDAYKVLNLRG
EARMDFLLDENNVPYLGEPNTLPGFTNMSLFKRLWDYSDINNAKLVDMLIDYGFEDFAQNKKLSYSFVSLGEEKIGKFN
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:27

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"