CATH Domain: 1eh9A02 XML data for domain: 1eh9A02

Molscript image for 1eh9A02
1eh9A02
PDB coordinates for domain 1eh9A02

PDB 1eh9, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.40 Immunoglobulin-like
2.60.40.1180 Golgi alpha-mannosidase II Gene3D
2.60.40.1180.35
2.60.40.1180.35.1
2.60.40.1180.35.1.1
2.60.40.1180.35.1.1.1
2.60.40.1180.35.1.1.1.1

[top]
Segment boundaries for domain 1eh9A02

Chopping figure for domain 1eh9A02
DomainStart PDB ResidueStop PDB Residue
1eh9A01 96 427
1eh9A01 463 492
1eh9A02 496 557
1eh9A03 1 87

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 2.60.40.1180.35.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1qwrA02 76.92 Amino sugar and nucleotide sugar metabolismBacillus subtilisMannose-6-phosphate isomerase [EC:5.3.1.8]Putative mannose-6-phosphate isomerase yvyIFructose and mannose metabolism 2.60.120.10 86 1 72 3.35 4.65
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1eh9A02
NVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1eh9A02
NVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYKL
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:44

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:44

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:27

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"