Set cath from cathlist by auto on 05 Mar 2006 18:53
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1eg7A01 | 1007 | 1131 |
| 1eg7A01 | 1251 | 1445 |
| 1eg7A02 | 1132 | 1250 |
| 1eg7A03 | 1446 | 1535 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1eg7A03 SIKDKIAKIATEIYGADGVNYTAEADKAIQRYESLGYGNLPVVMAKTQYSFSDDMTKLGRPRNFTITVREVRLSAGGRLI VPITGAIMTM
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"