CATH Domain: 1eg5B01 XML data for domain: 1eg5B01

Molscript image for 1eg5B01
1eg5B01
PDB coordinates for domain 1eg5B01

PDB 1eg5, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1150 Aspartate Aminotransferase, domain 1
3.90.1150.10 Aspartate Aminotransferase, domain 1 Gene3D
3.90.1150.10.39
3.90.1150.10.39.1
3.90.1150.10.39.1.1
3.90.1150.10.39.1.1.1
3.90.1150.10.39.1.1.1.1

[top]
Segment boundaries for domain 1eg5B01

Chopping figure for domain 1eg5B01
DomainStart PDB ResidueStop PDB Residue
1eg5B01 2 13
1eg5B01 258 365
1eg5B02 14 257

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.39.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1m32A01 86.12 2-aminoethylphosphonate--pyruvate transaminaseSalmonella enterica subsp. enterica serovar Typhimurium2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]Phosphonate and phosphinate metabolismMetabolic pathways 3.90.1150.10 110 13 88 2.14 2.43
1jg8A02 84.47 Thermotoga maritimaThreonine aldolase [EC:4.1.2.5]Glycine, serine and threonine metabolismMetabolic pathwaysL-allo-threonine aldolase 3.90.1150.10 96 11 77 2.77 3.58
1iugA01 82.83 Thermus thermophilusAspartate aminotransferase 3.90.1150.10 111 10 86 2.50 2.89
1uu2B01 80.69 Thermotoga maritimaTyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.90.1150.10 117 18 74 3.04 4.09
1svvB02 80.40 Leishmania major strain FriedlinThreonine aldolase [EC:4.1.2.5]Glycine, serine and threonine metabolismMetabolic pathwaysPutative uncharacterized protein 3.90.1150.10 88 17 73 3.49 4.74
1d2fB01 78.17 Nitrogen metabolismSelenoamino acid metabolismSulfur metabolismMetabolic pathwaysCysteine and methionine metabolism 3.90.1150.10 124 9 78 3.86 4.93
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1eg5B01
RVYFDNNATTRVLSEAAKHEKLRSKLVSGLNLGAHIITPLEISLPNTLSVSFPNIRGSTLQNLLSGYGIYVSTRHVLDAG
VDRRIAQGAIRISLCKYNTEEEVDYF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1eg5B01
XRVYFDNNATTRVLSEAAKHXEKLRSKLVSGLXNLGAHIITPLEISLPNTLSVSFPNIRGSTLQNLLSGYGIYVSTSSAC
TSKDERLRHVLDAXGVDRRIAQGAIRISLCKYNTEEEVDYF
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:37

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:37

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:27

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"