Set cath from cathlist by auto on 05 Mar 2006 19:34
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
CATH Domain: 1efyA02
1efyA02
PDB 1efy, Chain A, Domain 2
Segment boundaries for domain 1efyA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1efyA01 | 662 | 797 |
| 1efyA02 | 798 | 1010 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 3.90.228.10.1.2.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
3kr7A00 | 84.19 | 3.90.228.10 | 207 | 24 | 80 | 2.98 | 3.71 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|1efyA02 RTDIKVVDKDSEEAKIIKQYVKNTHAATHNAYDLKVVEIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGL RIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQADPIGLILLGEVALGNMYELKNASHITKLPKGKHSVKGLGKTAPD PTATTTLDGVEVPLGNGISTGINDTCLLYNEYIVYDVAQVNLKYLLKLKFNYK
Domain History Events (3)
Flow stage update by auto on 05 Mar 2006 19:34
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
Insertion by auto on 05 Mar 2006 16:27
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
