CATH Domain: 1eemA02 XML data for domain: 1eemA02

Molscript image for 1eemA02
1eemA02
PDB coordinates for domain 1eemA02

PDB 1eem, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.17
1.20.1050.10.17.1
1.20.1050.10.17.1.1
1.20.1050.10.17.1.1.1
1.20.1050.10.17.1.1.1.1

[top]
Segment boundaries for domain 1eemA02

Chopping figure for domain 1eemA02
DomainStart PDB ResidueStop PDB Residue
1eemA01 5 102
1eemA01 218 241
1eemA02 103 217

Structural Neighbourhood (12 entries)

There are 12 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.17.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 12 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gnwA02 87.03 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 11 89 2.22 2.48
1aw9A02 86.46 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 13 90 2.44 2.68
2dsaA02 86.21 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismBurkholderia xenovorans LB400 1.20.1050.10 106 10 89 2.62 2.93
1n2aA02 85.28 Metabolism of xenobiotics by cytochrome P450Glutathione metabolismGlutathione S-transferase [EC:2.5.1.18]Glutathione S-transferaseEscherichia coli K-12 1.20.1050.10 106 14 88 2.49 2.81
1gwcA02 84.94 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 23 81 2.39 2.93
1hqoA02 84.68 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 13 84 2.54 2.99
2gsqA02 84.34 Ommastrephes sloaniGlutathione S-transferase 1.20.1050.10 108 17 89 2.99 3.34
2vo4A02 84.20 2,4-D inducible glutathione S-transferaseGlycine max 1.20.1050.10 132 23 82 2.40 2.91
1v2aA02 83.17 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 12 84 2.61 3.10
1nhyA02 82.54 Positive regulation of transcription from RNA polymerase II promoterCalcium ion bindingNucleusElongation factor 1-gamma 1Transcription coactivator activity 1.20.1050.10 139 17 80 2.58 3.20
2c3nA02 80.44 Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism 1.20.1050.10 160 14 70 2.45 3.47
1dugA02 79.30 Fibrinogen gamma chainGlutathione S-transferase class-mu 26 kDa isozymeExternal side of plasma membraneFibrinogen complexEukaryotic cell surface binding 1.20.1050.10 105 13 82 4.01 4.85
[1]
Displaying entries 1 to 12 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1eemA02
LPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFE
RLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1eemA02
LPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFE
RLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLT
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:27

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"