Set cath from cathlist by auto on 05 Mar 2006 19:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1edzA01 | 3 | 10 |
| 1edzA01 | 149 | 296 |
| 1edzA02 | 13 | 120 |
| 1edzA02 | 297 | 319 |
There are 3 matching structural neighberhood comparisons for CATH ID 3.40.192.10.12.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2rgyA01 | 77.91 | 3.40.50.2300 | 122 | 8 | 71 | 2.84 | 3.96 | |
![]() |
2obxA00 | 77.87 | 3.40.50.960 | 150 | 4 | 71 | 2.71 | 3.80 | |
![]() |
2q5cA01 | 77.58 | 3.40.50.2300 | 97 | 7 | 70 | 2.70 | 3.84 |
>pdb|1edzA02 VAETFNTEIINNVEEYKKTHNGQGPLLVGFLANNDPAAKMYATWTQKTSESMGFRYDLRVIEDKDFLEEAIIQANGDDSV NGIMVYFPVFGNAQDQYLQQVVCKEKDVKVTIAMLLRNMLRLVRNVELSKE
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"