CATH Domain: 1edxA00 XML data for domain: 1edxA00

Molscript image for 1edxA00
1edxA00
PDB coordinates for domain 1edxA00

PDB 1edx, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.840 Ion Transport, Rhodopsin; Chain A
4.10.840.10 Ion Transport, Rhodopsin; Chain A Gene3D
4.10.840.10.1
4.10.840.10.1.1
4.10.840.10.1.1.1
4.10.840.10.1.1.1.1
4.10.840.10.1.1.1.1.1

[top]
Segment boundaries for domain 1edxA00

Chopping figure for domain 1edxA00
DomainStart PDB ResidueStop PDB Residue
1edxA00 1 40

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1edxA00
MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWEFSML
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1edxA00
MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWEFSML
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:39

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:39

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:02

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"