Insertion by lewis on 18 Jan 2007 19:06
Rechopping chains just before release v3.1.0 in order to fix missing fragments.
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ecrA01 | 6 | 173 |
| 1ecrA01 | 236 | 281 |
| 1ecrA02 | 174 | 235 |
| 1ecrA02 | 295 | 309 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1ecrA01 LVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSEN RSSKAAVRLPGVLCYQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHDP ATLRFGWAVQPIARVWYKGDQKQVQHACPTPLIALINRDNGAGVPDVGELLNYD
Rechopping chains just before release v3.1.0 in order to fix missing fragments.
Reassigning this domain to its previous classification as part of fragment fixing process in preparation for release v3.1.0.