CATH Domain: 1ebdA03 XML data for domain: 1ebdA03

Molscript image for 1ebdA03
1ebdA03
PDB coordinates for domain 1ebdA03

PDB 1ebd, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.30 Gene3D
3.30.390.30.11
3.30.390.30.11.1
3.30.390.30.11.1.1
3.30.390.30.11.1.1.1
3.30.390.30.11.1.1.1.1

[top]
Segment boundaries for domain 1ebdA03

Chopping figure for domain 1ebdA03
DomainStart PDB ResidueStop PDB Residue
1ebdA01 7 151
1ebdA01 273 346
1ebdA02 152 272
1ebdA03 347 461

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.390.30.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1xdiA03 92.42 Citrate cycle (TCA cycle)Valine, leucine and isoleucine degradationPyruvate metabolismGlycine, serine and threonine metabolismMetabolic pathways 3.30.390.30 122 28 94 1.24 1.32
3etrB03 76.02 Bos taurusXanthine dehydrogenase/oxidase 3.30.390.50 116 2 67 3.29 4.89
1xhcA03 71.18 Pyrococcus furiosusNADH oxidase /nitrite reductase 3.30.390.30 48 16 40 1.91 4.67
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ebdA03
AIPAVVFSDPECASVGYFEQQAKDEGIDVIAAKFPFAANGRALALNDTDGFLKLVVRKEDGVIIGAQIIGPNASDMIAEL
GLAIEAGMTAEDIALTIHAHPTLGEIAMEAAEVAL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ebdA03
AIPAVVFSDPECASVGYFEQQAKDEGIDVIAAKFPFAANGRALALNDTDGFLKLVVRKEDGVIIGAQIIGPNASDMIAEL
GLAIEAGMTAEDIALTIHAHPTLGEIAMEAAEVAL
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"