CATH Domain: 1eazA00 XML data for domain: 1eazA00

Molscript image for 1eazA00
1eazA00
PDB coordinates for domain 1eazA00

PDB 1eaz, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.29 PH-domain like
2.30.29.30 Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) Gene3D
2.30.29.30.5
2.30.29.30.5.1
2.30.29.30.5.1.1
2.30.29.30.5.1.1.1
2.30.29.30.5.1.1.1.1

[top]
Segment boundaries for domain 1eazA00

Chopping figure for domain 1eazA00
DomainStart PDB ResidueStop PDB Residue
1eazA00 190 293

Structural Neighbourhood (41 entries)

There are 41 matching structural neighberhood comparisons for CATH ID 2.30.29.30.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 41 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1faoA00 92.61 Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositidePhosphatidylinositol-3,4,5-trisphosphate bindingDual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositidePlasma membraneB cell receptor signaling pathway 2.30.29.30 100 37 96 1.79 1.86
1qqgA01 90.14 Phosphoinositide 3-kinase bindingAldosterone-regulated sodium reabsorptionNeurotrophin signaling pathwayNegative regulation of insulin secretionInsulin-like growth factor receptor signaling pathway 2.30.29.30 103 25 88 1.35 1.53
3cxbB00 89.92 Kinesin bindingPleckstrin homology domain-containing family M member 2Golgi organizationHomo sapiens 2.30.29.30 102 14 93 1.45 1.56
1u5dA00 89.88 Positive regulation of transcription from RNA polymerase II promoterPlasma membraneT cell receptor signaling pathwayAntigen bindingCytoplasm 2.30.29.30 108 23 94 1.83 1.94
2i5fA00 89.09 Soluble fractionInhibition of phospholipase C activity involved in G-protein coupled receptor signaling pathwayActin cytoskeleton reorganizationHemopoietic progenitor cell differentiationRuffle organization 2.30.29.30 92 34 86 1.70 1.97
2dn6A00 88.52 CytoplasmPlasma membraneSwitch-associated protein 70Homo sapiens 2.30.29.30 115 32 87 1.70 1.94
1qqgA02 88.29 Phosphoinositide 3-kinase bindingAldosterone-regulated sodium reabsorptionNeurotrophin signaling pathwayNegative regulation of insulin secretionInsulin-like growth factor receptor signaling pathway 2.30.29.30 104 14 89 2.20 2.46
1btnA00 87.99 Mus musculusSpectrin beta chain, brain 1SMAD protein import into nucleusCuticular platePlasma membrane 2.30.29.30 106 20 85 1.65 1.92
1omwA05 87.89 MembraneNegative regulation of the force of heart contraction by chemical signalG-protein coupled receptor kinase activityChemokine signaling pathwayMuscarinic acetylcholine receptor signaling pathway 2.30.29.30 101 23 89 1.82 2.04
2he7A03 86.37 Tight junctionErythrocyte membrane protein band 4.1Homo sapiensBand 4.1-like protein 3Cell-cell junction 2.30.29.30 95 8 83 1.64 1.96
1t77A01 86.19 Lipopolysaccharide-responsive and beige-like anchor proteinHomo sapiensProtein binding 2.30.29.40 105 5 85 4.05 4.72
1zsqA01 85.93 [EC:3.1.3.-]NucleusFructose and mannose metabolismMetabolic pathwaysRiboflavin metabolism 2.30.29.30 101 7 94 3.38 3.59
1ntyA02 85.89 Triple functional domain protein [EC:2.7.11.-]Triple functional domain proteinHomo sapiensProtein serine/threonine kinase activityTransmembrane receptor protein tyrosine phosphatase signaling pathway 2.30.29.30 124 13 79 2.07 2.62
1v89A00 85.73 Homo sapiensRho GTPase-activating protein 25 2.30.29.30 118 27 86 2.65 3.07
1dynA00 85.62 GTPase activityReceptor-mediated endocytosisHomo sapiensDynamin-1Protein binding 2.30.29.30 113 19 89 3.16 3.54
1ef1A03 85.39 Receptor bindingLeukocyte migrationCytoskeletonMembrane to membrane dockingNucleolus 2.30.29.30 95 11 85 1.82 2.13
1plsA00 85.34 Soluble fractionInhibition of phospholipase C activity involved in G-protein coupled receptor signaling pathwayHemopoietic progenitor cell differentiationActin cytoskeleton reorganizationRegulation of cell diameter 2.30.29.30 113 29 89 2.25 2.52
1txdA02 85.11 Rho guanine nucleotide exchange factor 12Homo sapiensRegulation of actin cytoskeletonG-protein-coupled receptor bindingG-protein coupled receptor protein signaling pathway 2.30.29.30 121 14 78 2.16 2.75
1p5tA00 84.44 Mus musculusRas protein signal transductionDocking protein 1Transmembrane receptor protein tyrosine kinase signaling pathwayTransmembrane receptor protein tyrosine kinase signaling protein activity 2.30.29.30 105 13 83 2.64 3.15
2coaA01 84.41 Homo sapiensSerine/threonine-protein kinase D2 2.30.29.30 118 24 85 2.60 3.04
1mixA02 83.99 Talin-1Focal adhesionFocal adhesionGallus gallusTalin 2.30.29.30 93 9 87 2.97 3.40
2rgnB02 83.97 Homo sapiensGuanine nucleotide exchange factor GEFT 2.30.29.30 123 14 78 2.26 2.90
2dhjA00 83.89 Rho GTPase-activating protein 21Homo sapiens 2.30.29.30 125 18 80 2.25 2.81
1ddwA00 83.29 DendriteType 5 metabotropic glutamate receptor bindingRattus norvegicusResponse to cocaineResponse to stress 2.30.29.30 109 4 84 2.63 3.12
1kz7C02 83.25 Mus musculusGuanine nucleotide exchange factor DBSRho guanyl-nucleotide exchange factor activityRho protein signal transductionLamellipodium 2.30.29.30 134 16 70 2.15 3.03
1evhA00 82.99 LamellipodiumFocal adhesionSH3 domain bindingStress fiberActin polymerization or depolymerization 2.30.29.30 111 6 85 2.75 3.21
1w1hD00 82.79 3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]PPAR signaling pathwayPeptidyl-threonine phosphorylationAldosterone-regulated sodium reabsorptionNon-small cell lung cancer 2.30.29.30 137 17 67 2.13 3.17
1btkA00 82.58 Induction of apoptosis by extracellular signalsPhosphatidylinositol-3,4,5-trisphosphate bindingIdentical protein bindingPlasma membraneB cell receptor signaling pathway 2.30.29.30 160 18 63 2.24 3.51
2p8vA00 82.56 Homer protein homolog 3Metabotropic glutamate receptor signaling pathwayProtein targetingHomo sapiensProtein binding 2.30.29.30 117 4 79 2.65 3.33
1aqcB00 82.29 Nervous system developmentSynaptic transmissionCell adhesionAmyloid beta (A4) precursor protein-binding, family A, member 1 (X11)Axon cargo transport 2.30.29.30 114 4 73 3.01 4.08
1v88A00 82.19 Oxysterol-binding protein-related protein 8Homo sapiens 2.30.29.30 130 14 75 2.58 3.42
1pfjA00 82.06 Positive regulation of transcription from RNA polymerase II promoterGeneral RNA polymerase II transcription factor activityGeneral transcription factor IIH subunit 1Nucleotide excision repairRegulation of cyclin-dependent protein kinase activity 2.30.29.30 108 5 84 2.78 3.30
1xr0B01 82.03 Fibroblast growth factor receptor substrate 2Membrane fractionIntegral to plasma membraneTransmembrane receptor protein tyrosine kinase adaptor activityNeurotrophin signaling pathway 2.30.29.30 91 5 82 2.95 3.57
1dbhA02 81.65 Jak-STAT signaling pathwayPathways in cancerChemokine signaling pathwayNeurotrophin signaling pathwayNon-small cell lung cancer 2.30.29.30 124 17 75 2.59 3.45
1ki1B02 80.24 Synaptic vesicle endocytosisHomo sapiensProtein bindingIntersectin-1 2.30.29.30 142 20 62 1.83 2.92
1rrpB00 79.62 E3 SUMO-protein ligase RanBP2Ran GTPase bindingNuclear poreProtein import into nucleusHomo sapiens 2.30.29.30 134 8 70 2.69 3.79
1ntvA00 78.67 Radial glia guided migration of Purkinje cellDisabled homolog 1Cell-cell adhesion involved in neuronal-glial interactions involved in cerebral cortex radial glia guided migrationNegative regulation of cell adhesionMus musculus 2.30.29.30 152 7 62 3.01 4.82
1q67A01 78.23 MRNA-decapping enzyme subunit 1Cytoplasmic mRNA processing bodyRNA degradationEnzyme activator activityMRNA binding 2.30.29.30 140 4 65 3.24 4.98
3f5rA00 77.53 DNA-dependent DNA replicationPositive regulation of RNA polymerase II transcriptional preinitiation complex assemblyDNA replication-independent nucleosome organizationProtein bindingFACT complex subunit POB3 2.30.29.30 107 11 84 3.85 4.58
1mkeA00 76.68 Rattus norvegicusNeural Wiskott-Aldrich syndrome protein 2.30.29.30 144 10 65 3.17 4.86
1ddmA00 76.25 Notch signaling pathwaySensory organ precursor cell fate determinationSensory organ precursor cell divisionProtein localizationDrosophila melanogaster 2.30.29.30 135 8 69 2.96 4.25
[1]
Displaying entries 1 to 41 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1eazA00
SAVIKAGYCVKQGAVMKNWKRRYFQLDENTIGYFKSELEKEPLRVIPLKEVHKVQECKQSDIMMRDNLFEIVTTSRTFYV
QADSPEEMHSWIKAVSGAIVAQRG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1eazA00
GSMFTPKPPQDSAVIKAGYCVKQGAVMKNWKRRYFQLDENTIGYFKSELEKEPLRVIPLKEVHKVQECKQSDIMMRDNLF
EIVTTSRTFYVQADSPEEMHSWIKAVSGAIVAQRGPGRSASSEHP
BLAST against CATH

[top]
Domain History Events (134)

Domain assigned by cuff on 16 Feb 2010 14:31

homology match

Domain assignment manual match h by cuff on 16 Feb 2010 14:27

same superfamily

Homcheck review by cuff on 16 Feb 2010 14:27

same superfamily

Flow stage update by cuff on 16 Feb 2010 14:27

same superfamily

Homcheck allotment by cuff on 16 Feb 2010 14:22

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 16 Feb 2010 14:22

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 25 Jan 2010 15:13

Calculated SCOP results for 1eazA00 and inserted them into the database.

Domain scan scop cath by auto on 25 Jan 2010 15:13

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 56 results for 1eazA00

Flow stage update by auto on 25 Jan 2010 15:12

Retrieved PRC_PFAMCATH results for job ID SID7061197564669376 and results inserted.

Domain scan prc pfamcath by auto on 25 Jan 2010 15:11

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 45 results for 1eazA00

Update comment by auto on 25 Jan 2010 08:52

PRC_PFAMCATH job SID7061197564669376 is not yet finished.

Flow stage update by auto on 25 Jan 2010 08:52

The entry "1eazA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 25 Jan 2010 08:52

The entry "1eazA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 Jan 2010 03:37

Unable to retrieve "1eazA00" PRC_PFAMCATH results for job "SID0151529792273696"

Update comment by auto on 24 Jan 2010 22:05

PRC_PFAMCATH job SID0151529792273696 is not yet finished.

Flow stage update by auto on 24 Jan 2010 22:05

The entry "1eazA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 24 Jan 2010 22:05

The entry "1eazA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 24 Jan 2010 22:04

Retrieved SSAP results for job ID SID6776427503475360 and results inserted.

Domain scan ssap cath by auto on 24 Jan 2010 21:47

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 4009 results for 1eazA00

Update comment by auto on 24 Jan 2010 08:00

SSAP job SID6776427503475360 is not yet finished.

Flow stage update by auto on 24 Jan 2010 08:00

The entry "1eazA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 24 Jan 2010 08:00

The entry "1eazA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 24 Jan 2010 01:49

Unable to retrieve "1eazA00" SSAP results for job "SID6201368500938720"

Update comment by auto on 23 Jan 2010 11:55

SSAP job SID6201368500938720 is not yet finished.

Ssap cath submit by auto on 23 Jan 2010 11:54

The entry "1eazA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Jan 2010 11:54

The entry "1eazA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Jan 2010 07:25

Giving up on SSAP job SID2790233826181130 because submission time of Sun Jan 17 05:16:47 2010 is more than 518400 seconds older than current time (Sat Jan 23 07:25:55 2010).

Update comment by auto on 17 Jan 2010 05:23

SSAP job SID2790233826181130 is not yet finished.

Flow stage update by auto on 17 Jan 2010 05:16

The entry "1eazA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 17 Jan 2010 05:16

The entry "1eazA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 17 Jan 2010 05:04

Retrieved PRC results for job ID SID7777980835046016 and inserted them into the database.

Domain scan prc cath by auto on 17 Jan 2010 05:03

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 38 results for 1eazA00

Flow stage update by auto on 17 Jan 2010 04:31

The entry "1eazA00" has been submitted to the PRC webservice.

Prc cath submit by auto on 17 Jan 2010 04:31

The entry "1eazA00" has been submitted to the PRC webservice.

Flow stage update by auto on 17 Jan 2010 04:14

Retrieved HMM(SAM) results for job ID SID7845992559757098 and inserted them into the database.

Domain scan sam cath by auto on 17 Jan 2010 04:13

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 30 results for 1eazA00

Update comment by auto on 16 Jan 2010 20:13

HMM(SAM) job SID7845992559757098 is not yet finished.

Sam cath submit by auto on 16 Jan 2010 20:10

The entry "1eazA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 16 Jan 2010 20:10

The entry "1eazA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 16 Jan 2010 16:19

Unable to retrieve "1eazA00" HMM(SAM) results for job "SID4757556885891512"

Update comment by auto on 16 Jan 2010 13:18

HMM(SAM) job SID4757556885891512 is not yet finished.

Flow stage update by auto on 16 Jan 2010 13:15

The entry "1eazA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 16 Jan 2010 13:15

The entry "1eazA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 16 Jan 2010 13:06

Retrieved "1eazA00" CATHEDRAL results for job ID SID4806405753202640 and inserted them into the database.

Domain scan cathedral cath by auto on 16 Jan 2010 13:05

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 21 results for 1eazA00

Flow stage update by auto on 16 Jan 2010 12:41

The entry "1eazA00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 16 Jan 2010 12:41

The entry "1eazA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Jan 2010 06:05

Unable to retrieve "1eazA00" CATHEDRAL results for job "SID0254682374266592"

Update comment by auto on 15 Jan 2010 22:01

"1eazA00" CATHEDRAL job SID0254682374266592 is not yet finished.

Cathedral cath submit by auto on 15 Jan 2010 21:54

The entry "1eazA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 15 Jan 2010 21:54

The entry "1eazA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 15 Jan 2010 21:49

ScanList with 13494 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1eazA00.scanlist" for "1eazA00"

Write scan list by auto on 15 Jan 2010 21:49

Writing ScanList containing 13494 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1eazA00.scanlist" for domain "1eazA00"

Update comment by auto on 15 Jan 2010 15:55

Waiting for 11 new domains (example : 3gsvA02) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jan 2010 11:07

Waiting for 37 new domains (example : 3gsdC00) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jan 2010 18:16

Waiting for 45 new domains (example : 3grpB00) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jan 2010 16:27

Waiting for 89 new domains (example : 3gqlC02) to be processed so that they can be scanned against too.

Update comment by auto on 13 Jan 2010 20:58

Waiting for 126 new domains (example : 3gpwF00) to be processed so that they can be scanned against too.

Update comment by auto on 13 Jan 2010 19:40

Waiting for 226 new domains (example : 3fmnA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jan 2010 20:58

Waiting for 262 new domains (example : 3fioB00) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jan 2010 17:37

Waiting for 422 new domains (example : 2wzjC03) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jan 2010 17:41

Waiting for 473 new domains (example : 2wbbF02) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jan 2010 16:26

Waiting for 487 new domains (example : 2w4nH02) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jan 2010 10:50

Waiting for 476 new domains (example : 2chuA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jan 2010 05:20

Waiting for 459 new domains (example : 2chuA01) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jan 2010 18:10

Waiting for 438 new domains (example : 2chuA01) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jan 2010 13:43

Waiting for 435 new domains (example : 2chuA01) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jan 2010 02:14

Waiting for 420 new domains (example : 2chuA01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Jan 2010 21:59

Waiting for 417 new domains (example : 2chuA01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Jan 2010 17:53

Waiting for 401 new domains (example : 2chuA01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Jan 2010 15:57

Waiting for 388 new domains (example : 2chuA01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Jan 2010 01:49

Waiting for 334 new domains (example : 2chuA01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Jan 2010 18:13

Waiting for 315 new domains (example : 2chuA01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Jan 2010 04:20

Waiting for 254 new domains (example : 2chuA01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jan 2010 19:38

Waiting for 234 new domains (example : 2chuA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jan 2010 21:40

Waiting for 89 new domains (example : 2kbkA00) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jan 2010 17:43

Waiting for 46 new domains (example : 2kbkA00) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jan 2010 15:42

Waiting for 38 new domains (example : 2kbkA00) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jan 2010 08:10

Waiting for 11 new domains (example : 2kbkA00) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jan 2010 01:45

Waiting for 15 new domains (example : 3govB02) to be processed so that they can be scanned against too.

Update comment by auto on 05 Jan 2010 17:40

Waiting for 57 new domains (example : 3gn9A01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Jan 2010 14:53

Waiting for 125 new domains (example : 3glfJ01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Jan 2010 06:25

Waiting for 155 new domains (example : 3gkxB00) to be processed so that they can be scanned against too.

Update comment by auto on 05 Jan 2010 00:49

Waiting for 219 new domains (example : 3gjgA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Jan 2010 17:39

Waiting for 259 new domains (example : 3giuA00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Jan 2010 16:26

Waiting for 346 new domains (example : 3ggxB00) to be processed so that they can be scanned against too.

Update comment by auto on 03 Jan 2010 15:23

Waiting for 371 new domains (example : 3ggaC00) to be processed so that they can be scanned against too.

Update comment by auto on 03 Jan 2010 11:14

Waiting for 509 new domains (example : 3gbsA00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Jan 2010 14:59

Waiting for 546 new domains (example : 3g9wA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Jan 2010 01:51

Waiting for 580 new domains (example : 2jerG00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Jan 2010 05:29

Waiting for 589 new domains (example : 1al6A01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Dec 2009 11:57

Waiting for 599 new domains (example : 1al6A01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Dec 2009 06:41

Waiting for 725 new domains (example : 1al6A01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Dec 2009 14:18

Waiting for 747 new domains (example : 3a28F00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Dec 2009 03:22

Waiting for 796 new domains (example : 1q1lD00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Dec 2009 21:13

Waiting for 788 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Dec 2009 18:44

Waiting for 785 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Dec 2009 15:09

Waiting for 764 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Dec 2009 13:08

Waiting for 761 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Dec 2009 02:48

Waiting for 734 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Dec 2009 22:14

Waiting for 730 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Dec 2009 17:58

Waiting for 715 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Dec 2009 15:39

Waiting for 711 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Dec 2009 08:56

Waiting for 681 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Dec 2009 02:48

Waiting for 674 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 27 Dec 2009 18:31

Waiting for 639 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 27 Dec 2009 14:57

Waiting for 627 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 26 Dec 2009 21:19

Waiting for 539 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 26 Dec 2009 17:10

Waiting for 514 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 25 Dec 2009 21:36

Waiting for 452 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 25 Dec 2009 16:58

Waiting for 445 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 25 Dec 2009 03:55

Waiting for 424 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 24 Dec 2009 20:34

Waiting for 421 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 24 Dec 2009 13:55

Waiting for 408 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 24 Dec 2009 08:51

Waiting for 395 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 23 Dec 2009 18:39

Waiting for 348 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 23 Dec 2009 15:49

Waiting for 333 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 23 Dec 2009 04:12

Waiting for 303 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 22 Dec 2009 19:29

Waiting for 289 new domains (example : 1q1lA00) to be processed so that they can be scanned against too.

Update comment by auto on 22 Dec 2009 12:51

Waiting for 209 new domains (example : 2e19A01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Dec 2009 07:44

Waiting for 188 new domains (example : 2kbwA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Dec 2009 21:57

Waiting for 115 new domains (example : 2kbwA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Dec 2009 18:11

Waiting for 41 new domains (example : 2kbwA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2009 22:07

Waiting for 9 new domains (example : 2kbwA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2009 17:20

Waiting for 166 new domains (example : 3g3eD02) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2009 02:03

Waiting for 212 new domains (example : 3g1sB00) to be processed so that they can be scanned against too.

Update comment by auto on 18 Dec 2009 19:14

Waiting for 358 new domains (example : 3fz1A01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Dec 2009 01:12

Waiting for 406 new domains (example : 3ffgL00) to be processed so that they can be scanned against too.

Flow stage update by auto on 18 Dec 2009 01:06

No satisfactory AssignClose result found.

Flow stage update by auto on 17 Dec 2009 23:39

No in_process hits for Domain "1eazA00" ready to be processed

Flow stage update by auto on 17 Dec 2009 23:39

NW result present for Domain "1eazA00"

Flow stage update by auto on 17 Dec 2009 23:39

All required files are present for Domain "1eazA00"

Flow stage update by auto on 16 Dec 2009 20:35

Beginning processing for Domain "1eazA00"

Insertion by lewis on 16 Dec 2009 16:04

Rechopping these chains with a tweak to erase tiny fragments that have appeared due to minor changes in the PDB.