Set cath from cathlist by auto on 05 Mar 2006 18:27
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1eaxA01 | 16 | 27 |
| 1eaxA01 | 121 | 232 |
| 1eaxA02 | 28 | 120 |
| 1eaxA02 | 233 | 244 |
There are 20 matching structural neighberhood comparisons for CATH ID 2.40.10.10.32.1.1.1.1 (SIMAX score < 5)
>pdb|1eaxA01 VVGGTDADEGEWICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGG VDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"