CATH Domain: 1eakA01 XML data for domain: 1eakA01

Molscript image for 1eakA01
1eakA01
PDB coordinates for domain 1eakA01

PDB 1eak, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.101 Muramoyl-pentapeptide Carboxypeptidase; domain 1
1.10.101.10 Muramoyl-pentapeptide Carboxypeptidase, domain 1 Gene3D
1.10.101.10.1
1.10.101.10.1.1
1.10.101.10.1.1.1
1.10.101.10.1.1.1.1
1.10.101.10.1.1.1.1.1

Segment boundaries for domain 1eakA01

Chopping figure for domain 1eakA01
DomainStart PDB ResidueStop PDB Residue
1eakA01 45 107
1eakA02 108 218
1eakA02 392 452
1eakA03 220 276
1eakA04 277 335
1eakA05 336 391

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.101.10.1.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1lbuA01 81.41 Streptomyces albus GZinc D-Ala-D-Ala carboxypeptidase 1.10.101.10 84 12 72 3.43 4.72
1slmA00 68.16 Stromelysin-1Metalloendopeptidase activityHomo sapiensMatrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]Intracellular membrane-bounded organelle 3.40.390.10 226 42 24 0.79 3.19
Displaying entries 1 to 2 (page 1 of 1)


Domain ATOM Sequence

>pdb|1eakA01
TDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDV    

Domain COMBS Sequence

>pdb|1eakA01
TDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDV    

Domain History Events (11)

Domain assigned by auto on 01 Nov 2006 18:06

Assigning to "1.10.101.10" based on similarity with "1eakB01"

Flow stage update by auto on 01 Nov 2006 18:03

No in_process hits for Domain "1eakA01" ready to be processed

Update comment by auto on 01 Nov 2006 14:25

Domain "1eakA01" hits Domain "1eakB01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:47

Domain "1eakA01" hits Domain "1eakB01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:48

Domain "1eakA01" hits Domain "1eakB01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:07

Domain "1eakA01" hits Domain "1eakB01" (100% over 100%) which is currently in process

Flow stage update by auto on 20 Oct 2006 13:48

Domain "1eakA01" hits Domain "1eakB01" (100% over 100%) which is currently in process

Flow stage update by auto on 20 Oct 2006 13:48

NW result present for Domain "1eakA01"

Flow stage update by auto on 19 Oct 2006 17:31

All required files are present for Domain "1eakA01"

Flow stage update by auto on 19 Oct 2006 01:40

Beginning processing for Domain "1eakA01"

Insertion by auto on 19 Oct 2006 01:25

Final ChopClose added based on similarity with "1eakB"