Set cath from cathlist by auto on 05 Mar 2006 18:02
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1e94E01 | 2 | 109 |
| 1e94E01 | 244 | 332 |
| 1e94E02 | 110 | 243 |
| 1e94E03 | 335 | 440 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1e94E02 MVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEKQKARKLKIKDAMKL LIEEEAAKLVNPEELKQDA
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"