Set cath from cathlist by auto on 05 Mar 2006 18:16
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1e8yA01 | 144 | 321 |
| 1e8yA02 | 357 | 522 |
| 1e8yA03 | 525 | 725 |
| 1e8yA04 | 726 | 883 |
| 1e8yA05 | 884 | 1084 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1e8yA05 DATTIAKIQQSTVGNTGFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHID FGHERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTV GKNEEDAKKYFLDQIEVCRDKGWTVQF
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"