CATH Domain: 1e8pA00 XML data for domain: 1e8pA00

Molscript image for 1e8pA00
1e8pA00
PDB coordinates for domain 1e8pA00

PDB 1e8p, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1220 Endoglucanase; Chain: A
3.90.1220.10 Gene3D
3.90.1220.10.1
3.90.1220.10.1.1
3.90.1220.10.1.1.1
3.90.1220.10.1.1.1.1
3.90.1220.10.1.1.1.1.1

[top]
Segment boundaries for domain 1e8pA00

Chopping figure for domain 1e8pA00
DomainStart PDB ResidueStop PDB Residue
1e8pA00 1 46

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1e8pA00
ASCWAQSQGYNCCNNPSSTKVEYTDASGQWGVQNGQWCGIDYSYGQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1e8pA00
ASCWAQSQGYNCCNNPSSTKVEYTDASGQWGVQNGQWCGIDYSYGQ
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:37

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:37

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:00

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"