Set cath from cathlist by auto on 05 Mar 2006 19:16
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1e6uA01 | 3 | 167 |
| 1e6uA01 | 210 | 248 |
| 1e6uA01 | 284 | 299 |
| 1e6uA02 | 168 | 209 |
| 1e6uA02 | 249 | 283 |
| 1e6uA02 | 300 | 316 |
There are 38 matching structural neighberhood comparisons for CATH ID 3.40.50.720.15.1.1.1.1 (SIMAX score < 5)
>pdb|1e6uA01 KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQ NMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVM PTNLYEFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGLLDVTRLHQLGWYHEI
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"