CATH Domain: 1e5kA00 XML data for domain: 1e5kA00

Molscript image for 1e5kA00
1e5kA00
PDB coordinates for domain 1e5kA00

PDB 1e5k, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.550 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A
3.90.550.10 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Gene3D
3.90.550.10.15
3.90.550.10.15.1
3.90.550.10.15.1.1
3.90.550.10.15.1.1.1
3.90.550.10.15.1.1.1.1

[top]
Segment boundaries for domain 1e5kA00

Chopping figure for domain 1e5kA00
DomainStart PDB ResidueStop PDB Residue
1e5kA00 4 191

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.90.550.10.15.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1w55A01 80.09 Terpenoid backbone biosynthesis2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase / 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:2.7.7.60 4.6.1.12]Campylobacter jejuniBifunctional enzyme ispD/ispFProtein binding 3.90.550.10 207 14 85 3.33 3.92
2px7A00 79.59 Terpenoid backbone biosynthesisMetabolic pathwaysThermus thermophilus HB82-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC:2.7.7.60]2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 3.90.550.10 203 12 84 2.50 2.97
1eziA00 79.22 Amino sugar and nucleotide sugar metabolismMetabolic pathwaysN-acylneuraminate cytidylyltransferaseN-acylneuraminate cytidylyltransferase [EC:2.7.7.43]Neisseria meningitidis 3.90.550.10 211 12 78 3.23 4.11
1qwjB00 78.22 Mus musculusN-acylneuraminate cytidylyltransferase 3.90.550.10 229 11 73 3.10 4.20
2i5eA01 75.77 Methanosarcina mazeiPutative uncharacterized protein 3.90.550.10 162 10 73 3.62 4.90
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1e5kA00
MTTITGVVLAGGKARRMGGVDKGLLELNGKPLWQHVADALMTQLSHVVVNANRHQEIYQASGLKVIEDSLADYPGPLAGM
LSVMQQEAGEWFLFCPCDTPYIPPDLAARLNHQRKDAPVVWVHDGERDHPTIALVNRAIEPLLLEYLQAGERRVMVFMRL
AGGHAVDFSDHKDAFVNVNTPEELARWQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1e5kA00
MNLMTTITGVVLAGGKARRMGGVDKGLLELNGKPLWQHVADALMTQLSHVVVNANRHQEIYQASGLKVIEDSLADYPGPL
AGMLSVMQQEAGEWFLFCPCDTPYIPPDLAARLNHQRKDAPVVWVHDGERDHPTIALVNRAIEPLLLEYLQAGERRVMVF
MRLAGGHAVDFSDHKDAFVNVNTPEELARWQEKRSHHHHHH
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:35

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:35

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:58

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"