CATH Domain: 1e4fT03 XML data for domain: 1e4fT03

Molscript image for 1e4fT03
1e4fT03
PDB coordinates for domain 1e4fT03

PDB 1e4f, Chain T, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.40 Gene3D
3.30.420.40.7
3.30.420.40.7.1
3.30.420.40.7.1.1
3.30.420.40.7.1.1.1
3.30.420.40.7.1.1.1.1

[top]
Segment boundaries for domain 1e4fT03

Chopping figure for domain 1e4fT03
DomainStart PDB ResidueStop PDB Residue
1e4fT01 85 171
1e4fT02 237 301
1e4fT03 7 84
1e4fT03 172 198
1e4fT03 360 390
1e4fT04 199 236
1e4fT04 303 359

Structural Neighbourhood (20 entries)

There are 20 matching structural neighberhood comparisons for CATH ID 3.30.420.40.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 20 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2d0oA01 85.60 Klebsiella oxytocaDiol dehydratase-reactivating factor large subunit 3.30.420.40 135 10 89 3.15 3.51
2qxlB01 84.45 ATP bindingCytoplasmAdenyl-nucleotide exchange factor activityHeat shock protein homolog SSE1Peptide binding 3.30.420.40 134 8 80 3.36 4.19
1huxA01 83.58 Activator of (R)-2-hydroxyglutaryl-CoA dehydrataseAcidaminococcus fermentans DSM 20731 3.30.420.40 119 15 80 3.12 3.86
3h1qA01 82.64 Ethanolamine utilization protein EutJCarboxydothermus hydrogenoformans Z-2901Ethanolamine utilization protein EutJ 3.30.420.40 152 13 79 3.15 3.96
2hoeA02 81.21 Thermotoga maritimaTranscriptional regulator, XylR-related 3.30.420.40 146 10 76 3.23 4.25
1jceA01 80.99 Thermotoga maritimaRod shape-determining protein MreB and related proteinsRod shape-determining protein MreB 3.30.420.40 147 12 70 2.38 3.40
2qm1A01 79.80 Galactose metabolismAmino sugar and nucleotide sugar metabolismGlucokinase [EC:2.7.1.2]Enterococcus faecalisMetabolic pathways 3.30.420.40 148 13 79 3.46 4.38
1woqA01 79.16 Inorganic polyphosphate/ATP-glucomannokinaseArthrobacter sp. KM 3.30.420.40 112 15 64 2.82 4.36
1z05A02 78.40 Vibrio choleraeTranscriptional regulator, ROK family 3.30.420.40 154 8 73 3.61 4.92
3bzcA03 78.24 Pseudomonas aeruginosaPutative uncharacterized protein 3.30.420.140 128 12 84 3.53 4.17
2qxlA03 76.71 Adenyl-nucleotide exchange factor activityHeat shock protein homolog SSE1Protein refoldingHeat shock protein 110kDaCytoplasm 3.30.420.40 93 10 56 2.23 3.94
1sz2B01 76.39 Galactose metabolismAmino sugar and nucleotide sugar metabolismMetabolic pathwaysStarch and sucrose metabolismGlycolysis / Gluconeogenesis 3.30.420.40 118 8 69 3.31 4.79
1ig8A02 76.01 Galactose metabolismRegulation of cell sizeMannose metabolic processGlucose importMetabolic pathways 3.30.420.40 134 8 70 3.49 4.94
1e4fT04 75.75 Thermotoga maritimaCell division protein FtsA, putativeCell division protein FtsA 3.30.420.40 89 12 56 2.28 4.03
1czaN03 75.20 Type II diabetes mellitusGalactose metabolismAmino sugar and nucleotide sugar metabolismButirosin and neomycin biosynthesisHexokinase [EC:2.7.1.1] 3.30.420.40 178 9 62 2.67 4.28
3i33A03 75.14 Cell surfaceResponse to unfolded proteinAntigen processing and presentationEndocytosisMale meiosis 3.30.420.40 89 10 55 2.33 4.17
1jcfA02 75.10 Thermotoga maritimaRod shape-determining protein MreB and related proteinsRod shape-determining protein MreB 3.30.420.40 89 8 58 2.74 4.72
1dt9A02 75.05 RNA bindingEukaryotic peptide chain release factor subunit 1Protein methylationProtein bindingCytoplasm 3.30.420.60 112 8 71 3.50 4.91
3h1qA02 74.70 Ethanolamine utilization protein EutJCarboxydothermus hydrogenoformans Z-2901Ethanolamine utilization protein EutJ 3.30.420.40 113 7 60 2.79 4.63
3epqA01 73.65 3.30.420.40 91 7 49 2.38 4.83
[1]
Displaying entries 1 to 20 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1e4fT03
TVFYTSIDIGSRYIKGLVLGKRDQEWEALAFSSVKSRGLDEGEIKDAIAFKESVNTLLKELEEQLQKSLRSDFVISFSMF
YNFLQDTVKSPFQLKSSLVSTAEGVCYANSDRPSIINADEVANDPSFAAAFGNVFA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1e4fT03
MIDLSKTVFYTSIDIGSRYIKGLVLGKRDQEWEALAFSSVKSRGLDEGEIKDAIAFKESVNTLLKELEEQLQKSLRSDFV
ISFSMFYNFLQDTVKSPFQLKSSLVSTAEGVCYANSDRPSIINADEVANDPSFAAAFGNVFA
BLAST against CATH

[top]
Domain History Events (3)

Classification merge by cuff on 27 Jun 2008 15:55

COMMENT: Kinases/phosphate transfer proteins/ATP binding
Merge 3.30.420.90 into 3.30.420.40 FINAL: i agree. merge 3.30.420.90 into 3.30.420.40

Domain assigned by lewis on 18 Jan 2007 19:06

Reassigning this domain to its previous classification as part of fragment fixing process in preparation for release v3.1.0.

Insertion by lewis on 18 Jan 2007 19:06

Rechopping chains just before release v3.1.0 in order to fix missing fragments.