CATH Domain: 1e0gA00 XML data for domain: 1e0gA00

Molscript image for 1e0gA00
1e0gA00
PDB coordinates for domain 1e0gA00

PDB 1e0g, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.350 Membrane-bound Lytic Murein Transglycosylase D; Chain A
3.10.350.10 Membrane-bound Lytic Murein Transglycosylase D; Chain A Gene3D
3.10.350.10.2
3.10.350.10.2.1
3.10.350.10.2.1.1
3.10.350.10.2.1.1.1
3.10.350.10.2.1.1.1.1

[top]
Segment boundaries for domain 1e0gA00

Chopping figure for domain 1e0gA00
DomainStart PDB ResidueStop PDB Residue
1e0gA00 1 48

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1e0gA00
DSITYRVRKGDSLSSIAKRHGVNIKDVMRWNSDTANLQPGDKLTLFVK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1e0gA00
DSITYRVRKGDSLSSIAKRHGVNIKDVMRWNSDTANLQPGDKLTLFVK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:52

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:52

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:16

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"