CATH Domain: 1dxsA00 XML data for domain: 1dxsA00

Molscript image for 1dxsA00
1dxsA00
PDB coordinates for domain 1dxsA00

PDB 1dxs, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.50 Transcription Factor, Ets-1 Gene3D
1.10.150.50.8
1.10.150.50.8.1
1.10.150.50.8.1.1
1.10.150.50.8.1.1.1
1.10.150.50.8.1.1.1.1

[top]
Segment boundaries for domain 1dxsA00

Chopping figure for domain 1dxsA00
DomainStart PDB ResidueStop PDB Residue
1dxsA00 6 62

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 1.10.150.50.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1x9xA00 89.23 MAPK signaling pathway - yeastSAM domain bindingIdentical protein bindingInvasive growth in response to glucose limitationActivation of MAPKK activity 1.10.150.50 62 22 91 1.63 1.77
1v38A00 85.12 Mus musculusSAM domain-containing protein SAMSN-1 1.10.150.50 78 15 73 1.31 1.79
1z1vA00 84.67 Protein kinase regulator activitySAM domain bindingProtein STE50Signal transduction involved in filamentous growthPheromone-dependent signal transduction involved in conjugation with cellular fusion 1.10.150.50 70 7 80 1.72 2.15
1x66A01 83.14 Sequence-specific DNA binding transcription factor activityHemostasisOrgan morphogenesisHomo sapiensFriend leukemia integration 1 transcription factor 1.10.150.50 70 12 77 2.57 3.33
2bcqA01 75.71 Nucleotide-excision repairBase excision repairNon-homologous end-joiningDNA polymerase lambdaDNA polymerase lambda subunit [EC:2.7.7.7 4.2.99.-] 1.10.150.110 80 10 63 3.02 4.74
1kl9A02 75.67 Translation initiation factor activityTranslation initiation factor eIF-2 alpha subunitEukaryotic translation initiation factor 2 subunit 1PolysomeHomo sapiens 1.10.150.190 92 10 60 2.47 4.06
2a19A02 75.11 Translation initiation factor activityTranslation initiation factor eIF-2 alpha subunitEukaryotic translation initiation factor 2 complexEukaryotic translation initiation factor 2 subunit alphaSaccharomyces cerevisiae 1.10.150.190 85 5 65 2.75 4.17
1dulA00 74.78 Protein exportBacterial secretion systemSignal recognition particle proteinGTP bindingSignal recognition particle subunit SRP54 1.10.260.30 61 5 90 4.18 4.64
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1dxsA00
SLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1dxsA00
GSYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDL
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:25

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"